KEGG   Miniopterus natalensis: 107524300
Entry
107524300         CDS       T05883                                 

Gene name
SCN5A
Definition
(RefSeq) sodium channel protein type 5 subunit alpha isoform X1
  KO
K04838  voltage-gated sodium channel type V alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107524300 (SCN5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107524300 (SCN5A)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107524300 (SCN5A)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc Na_trans_cytopl PKD_channel GPHH IQ
Other DBs
NCBI-GeneID: 107524300
NCBI-ProteinID: XP_016051654
LinkDB
Position
Unknown
AA seq 2016 aa
MADFLLPRGTSSFHRFTRESLAAIEKRMAEKQARGSATLQENHDGLPEEEALRPQLDLQA
SKKLPDLYGNPPRELLGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPI
RRAAVKILVHSLFSMLIMCTILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILARG
FCLHAFTFLRDPWNWLDFSVIIMAYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTIV
GALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTELNGTNGSVEADGLV
WDSLDLYLNDSENYLLKNGTSDVLLCGNSSDAGACPEGYRCLKAGQNPDHGYTSFDSFAW
AFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQN
QATIAETEEKEKRFQEAMEMLKKEQEALTIRGVDAMSRSSLDMSPLAQVATQENRSKRRK
RTSSGTEEYGDDRLPKSDSEDGPRAMNRLSITHGLSRSSVKPHSRRGSLFTFRRRDTGSE
TDFADDENSTAGDSESHRTSLLVPWALRRPSAQAQLSPGTSAPSHAPNGKRNSTVDCNGV
VSLLGAGDPEATSPGSHLLRPVMLEHPPDTTTPSEEPGRPLMLTPQAPGVDGFEGPGERQ
RALSAVSVLTSALEELEESHRKCPPCWNRFAQRYLIWECCPLWMSIKQKVKFMVMDPFAD
LTITMCIVVNTLFMALEHYNMTTEFEEMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQG
WNIFDSIIVILSLMELGLSRMGNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALG
NLTLVLAIIVFIFAVVGMQLFGKNYSEQRHRISDSGLLPRWHMMDFFHAFLIIFRILCGE
WIETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDGEMNN
LQLALARIQRGLRFLKRTTWDFCCGLLQRPQKPAALAPGGPLPGCVAASSPPPPTETEKA
PPARKETRFEEGQRPGQGSAGDPEPVCVPIAVAESDTDDQEGEENSLSTEEESSKQQEPQ
PVSGGPEALPEPSAWSQVSETASSEAEASVAQADWQQQRQVEPQAPGCSETHEDSYSEGS
TADMTNTADLLEQIPDLGEDVKDPEDCFTEGCVRRCPCCTVDTTQAPGKVWWRLRKTCYR
IVEHSWFETFIIFMILLSSGALAFEDIYLEERRTVKVLLEYADKMFTYVFVLEMLLKWVA
YGFKKYFTNAWCWLDFLIVGVSLISLVANTLGFSEMGPIKSLRTLRALRPLRALSRFEGM
RVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNN
KSNCESLNMTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQW
EYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKK
LGSKKPQKPIPRPLNKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKVNIL
GKINLLFVGIFTGECIIKMAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKYFFSPT
LFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFA
YVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNGSRG
NCGSPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEK
FDPEATQFIEYLALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKR
VLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATVIQRAFRRHLLQRS
VRHASFLFRQRGSSGLSGEAAPEQEGLIACKMNESFSPRPGPPSSSSISSTSFPPSYDSV
TRATSDNLQVRVSDYSRSEDLPDFLTSPDRDRESIV
NT seq 6051 nt   +upstreamnt  +downstreamnt
atggcagacttcctgttacctcggggcaccagcagcttccacaggttcacccgggagtcc
ctggcagccatcgagaagcgcatggcagagaagcaggcccgaggctcagccaccttgcag
gagaaccacgacgggctgcccgaggaggaggctctccggccccagctggacctgcaggcc
tccaaaaagctgccggatctctatggcaacccaccccgagagctcctcggggagcccctg
gaggacttggaccccttctatagcacccaaaagaccttcatcgtgctgaacaaaggcaag
accatcttccggttcagtgccaccaacgccttgtatgttctcagccccttccaccccatc
cggagagcggccgtgaagatcctggttcattcgctcttcagcatgctcatcatgtgcacc
atcctgaccaactgcgtgttcatggcccagcatgaccctccaccctggaccaagtatgtc
gagtacaccttcactgccatttacacctttgagtctctggtcaagatactggcccgaggc
ttctgcctgcacgcgttcaccttccttcgggacccgtggaactggctggacttcagcgtg
atcatcatggcatacacaactgaatttgtggacctgggcaatgtctcagctttacgcacc
ttccgagtcctccgggccctgaaaactatatcagtcatttcaggcctgaagaccattgtg
ggggccctgatccagtctgtgaagaagctggccgacgtgatggtcctcacggtcttctgc
ctcagtgtcttcgccctcattggcctgcagctcttcatgggtaacctgaggcacaagtgc
gtgcgcaacttcacggagctcaatggcaccaacggctctgtggaggccgatggcctggtc
tgggactcgctggacctctacctcaacgattcagaaaattacctgctcaagaacggcacc
tccgatgtgttactgtgtgggaacagctctgacgctggggcatgtcctgagggctaccgg
tgcctaaaggcgggccagaaccctgaccacggctacaccagcttcgattccttcgcctgg
gccttcctcgctcttttccgcctaatgacgcaggactgctgggagcgcctctaccagcag
accctgaggtccgcagggaagatctacatgatcttcttcatgcttgtcatcttcctgggc
tccttctacctggtgaacctgatcctggctgtggttgccatggcctacgaggagcaaaac
caagccaccatcgcagagacagaggagaaggaaaagcgattccaggaggccatggagatg
ctcaagaaagagcaggaggctctcaccatcaggggtgtggacgccatgtcccgcagctcc
ttggacatgtcccctttggcccaagtagccacccaggagaataggagcaagaggagaaaa
cggacgtcttcggggacggaggagtatggggatgacagactccccaagtctgactcagag
gatggtcccagagcaatgaaccgtctcagcatcacccacggcctcagcaggagctccgtg
aagccacactccaggcgtggcagccttttcacctttcgccggagagatacgggttcagag
acggattttgccgatgatgaaaacagcacagcgggggacagcgagagccaccgcacatca
ctactggtgccctgggccctgcgccggcctagtgcccaggcacagctcagtcctgggacc
tcagctcccagccatgcccccaatggcaaaaggaacagcaccgtagactgcaatggggta
gtctccttgctgggggcaggtgaccctgaggccacctccccagggagtcacctcctccgc
cctgtgatgctggagcaccccccagacacgaccactccgtcggaggagccaggcaggccc
ctgatgctgaccccccaggctcctggcgtggatggcttcgaggggccaggagagcggcag
cgggccctcagcgcagtcagtgtcctcaccagcgccctggaagagctggaggagtctcac
cgcaagtgtccgccatgctggaaccgcttcgcccagcgctacctgatctgggagtgctgc
cccctgtggatgtccatcaagcagaaggtgaagttcatggtcatggacccatttgccgac
ctcaccatcaccatgtgcatcgtggtcaacacgctcttcatggccctggagcactacaac
atgacgactgaatttgaggagatgctgcaggtcggaaacctggtcttcacagggatcttc
acagcagagatgaccttcaagatcatcgctctcgacccctactactacttccagcagggc
tggaacatctttgacagcatcatcgtcatcctcagcctcatggagctgggcctgtcccgc
atgggcaacctgtcagtgctgcgctcctttcgcctgctgcgggtcttcaagctggccaaa
tcatggcccacgctgaacactctcatcaagatcatcgggaactctgtgggcgcgctgggc
aatctgacgctggtgctggccatcatcgtgttcatcttcgccgtggtgggcatgcagctc
ttcggcaagaactactcagagcagaggcaccgcatcagcgactcgggcctgctgccgcgc
tggcacatgatggacttcttccacgccttcctcatcatcttccgcatcctctgcggcgag
tggatcgagaccatgtgggactgcatggaggtgtccgggcagtcgctgtgcctgcttgtc
ttcttgcttgtcatggtcattggcaatcttgtggtcctgaacctcttcctggccttgctg
ctcagctccttcagcgcggacaacctcacggcccccgacgaagacggcgagatgaacaac
ctgcagctggccctggcccggatccagcggggcctgcgcttcctcaagcggaccacctgg
gacttctgctgcgggctcctgcagcggcctcagaagcccgccgccctggcccccgggggc
ccgctgcccggctgcgtcgccgcctccagccccccacctcccacggagacggagaaggcc
cccccggcccgcaaggagacgcggttcgaggaaggccagcggccaggccagggctccgct
ggggacccggagcccgtgtgcgtgcccattgccgtggctgagtcagacaccgatgaccag
gagggcgaggagaacagcctgagcacagaggaagagtccagcaagcagcaggaaccccaa
cctgtgtccggcggcccagaggccctcccggagcccagcgcctggagccaggtgtcagag
accgcctcctccgaggccgaggctagtgtggctcaggcagactggcaacagcagcggcaa
gtggagccccaggccccagggtgcagtgagacccatgaggacagttactccgaggggagc
acagcagacatgaccaacacggctgacctcctggagcagatccccgacctcggcgaggac
gtcaaggacccagaggactgcttcaccgaaggctgtgtccggcgctgtccctgctgcact
gtggacaccacacaggccccagggaaggtctggtggcggctgcgcaagacctgctaccgc
attgtggagcacagctggttcgagacgttcatcatcttcatgatcctgctcagcagtgga
gctctggcctttgaggacatctacctggaggagcggaggaccgtcaaggttctgctcgaa
tacgccgacaagatgttcacctacgtcttcgtgctggagatgctgctcaagtgggtggcc
tacgggttcaagaagtacttcaccaacgcctggtgctggctcgacttcctcatcgtgggc
gtctcactgatcagtctggtggccaacaccctgggtttttctgagatgggccccatcaag
tcgctgcggacgttgcgggcactccgacccctgcgagccctgtcacgatttgagggcatg
agggttgtggtcaacgccctggtgggcgccatcccgtccatcatgaacgtcctcctcgtc
tgcctcatcttctggctcatcttcagcatcatgggcgtgaacctctttgcggggaagttt
gggaggtgtatcaaccagactgagggggacctgcctttaaactacaccatcgtgaacaac
aagagtaactgtgagtctctaaacatgaccggcgaactgtactggaccaaggtgaaagtc
aactttgacaacgtgggagctgggtacctggccctgctgcaggtggcaacatttaaaggc
tggatggacattatgtatgcggctgtggactccagagggtatgaagagcagccccagtgg
gaatacagcctctacatgtatatctacttcgtcgtgttcatcatcttcgggtccttcttc
accctgaaccttttcattggtgtcatcattgacaacttcaaccagcagaagaaaaagtta
gggggccaggacatcttcatgacagaggagcagaagaaatactacaacgccatgaagaag
ctgggctccaagaagccccagaagcccatcccaaggcctctgaacaagtaccagggcttc
atatttgacatcgtgaccaagcaggcctttgacgtcaccatcatgtttctcatctgcctg
aacatggtgaccatgatggtggagacggacgaccagagccctgagaaggtcaacatcttg
ggcaagatcaacctgctcttcgtaggcatcttcacaggcgagtgtatcatcaagatggct
gcgctgcggcactattacttcaccaacagctggaacatcttcgacttcgtggttgtcatc
ctctccatcgtgggcaccgtgctctcggacatcatccagaagtacttcttctcccctacg
ctcttccgagtcatccgcctggcccgcatcggccgcatcctcaggctgattcgcggggcc
aaggggatccgcacgctgctcttcgccctcatgatgtccctgcccgccctcttcaacatc
gggctgctgctcttccttgtcatgttcatctactccatctttggcatggccaacttcgcc
tacgtcaagtgggaggctggcatcgacgacatgttcaacttccagaccttcgccaacagc
atgctgtgcctcttccagatcaccacgtcggctggctgggatggtctcctcagccccatc
ctcaacacggggcccccctactgcgaccccaacctgcccaacagcaatggctcccggggg
aactgcgggagcccagccgtgggcatcctcttcttcaccacctacatcatcatctccttc
ctcatcgtggtcaacatgtacatcgccatcatcctggagaacttcagcgtggccacagag
gagagcaccgagcccctgagcgaggacgactttgacatgttctatgagatctgggagaag
ttcgacccggaggccacccagttcattgagtatttggcgctgtctgacttcgccgacgcc
ctgtctgagccgctgcggattgccaagcccaaccagataagcctcatcaacatggacctg
cccatggtgagcggggaccgtatccactgcatggacattctcttcgccttcaccaagagg
gtcctgggtgaatccggggagatggacgccctgaagatccagatggaagagaagttcatg
gcggccaacccgtccaagatctcctacgagcccatcaccaccacgctgcggcgcaagcac
gaggaggtgtcggccaccgtgatccagcgcgccttccgcaggcacctgctgcagcgctcc
gtgaggcacgcgtccttcctcttccgccagcggggcagcagcggcctgtccggggaggcc
gcccccgagcaagagggcctcatcgcctgcaagatgaacgagagcttctccccgcgcccc
ggcccgccctccagctcctccatctcctccacgtccttcccgccttcctacgacagcgtc
accagggccaccagcgataacctccaggtgcgggtgtctgactacagccgcagcgaagat
ctcccggacttcctcacgtcccccgacagggaccgagagtctattgtgtga

KEGG   Miniopterus natalensis: 107527010
Entry
107527010         CDS       T05883                                 

Gene name
SCN7A
Definition
(RefSeq) sodium channel protein type 7 subunit alpha
  KO
K04839  voltage-gated sodium channel type VII alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107527010 (SCN7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527010 (SCN7A)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107527010 (SCN7A)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc GPHH CitX IQ
Other DBs
NCBI-GeneID: 107527010
NCBI-ProteinID: XP_016055149
LinkDB
Position
Unknown
AA seq 1668 aa
MVASAKLKMASPEPKGLVAFTKESLELMEQRIAKKHNEEHGEEDLKPNPDLEVGKELPFV
YGNLPRGMVSEPLEDVDPYYQNQNTFMVLNKKRTIFRFNATWCTLSPFNLIRRTAVKILV
HPFFRLFILISVLIDCVFMSMTNLPKWGPELQITLLAIYTFEILVKLVARGIWTGSYYFF
GDPWNWLDFSVTLFEHITIYSPLNFILIFRIARSLRILKIIPLNQGVKSYVGTLLQCVKK
LTGVIILTLFFLSVFSLIGMGLFMGNLKHKCLRWPQENETETLHNRTRNPGYIRETENFY
YLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDNGYTNFDNFGWALLALFRLMTQDFPE
ALYHQVLYASGKVYMIFFIVISFWFAFYMASLFLGILAMSYEEEKQTATEKAKKMDPKFQ
HTLLQEENEAAETKTTQIEMKKRLPVSTLAPLDVLDAAAVSHEEHKNSQKRCPLCWYKFA
KIFLIWNCSPCWVKLKEFLHVIMMHPFTDLFLTMCIILNIYFLAMEYYPMSEEIFSVLSV
GNLVFIGIFTTEMIFKIIAMHPYGYFQVGWNIYDSLIVLHGLAELFLASVHGLAVLQSLR
VLRIFKLGKYWPTFKILLLTLTKSLVALKDLILLLFTFMFFSAIVGMRLFGLRYQEYACK
LDKDCQLPRWHMINFFHSYLNVFRILCGEWIETLWDCFDIASRFSCIPFYMMVILIGNLL
ILYLFLALVSFFSSYNAATAEENDEAKNLWRALARIKKGVSYVLSKILCKRLDGPKDTMD
HENNPRAKENISDHTLSELSNTQDFKVKERSTSTDKNTMTENESQSLIPSPSVSETVPIA
SGESDIENLDNKEIQSKSGYGSSKEKVKPSSSSECSTVDIALSEEEEMIYEHEKPKHHKN
SYERRSSPGQISRDSKRGKIWRNIRKTCCKIVENSFFKCFIGLVTLLSTGALAFEDIYID
QRKTIKILLEYADMIFTYIFILEMLLKWMAYGLKAYFTNGWYRLDFMVVIVFCLNLIGKS
REELKLLASIKFLRALRVLSQFERMKVVVRALIKTTLPALNVFLVCLMIWLAFSIMGVCL
FAGKFYQCIDPTSGERFPTYEVRNKNHCESLILNESMPWENAKLNFDNVGNGFLSLLQVA
TFNGWISIMNSAVDSTGVDMQPEFEKNIYMYCYFLVFIVIGLFLPLTMLIGVILANFNKH
KIKQGGSNIFITEKQKKQYCALKKLMCENSQKIIPRPGNKFQRFIFDLVTSQVFNIVIMV
LICLQAITIMIESDGQSSQMDTALIWINLVFVMLYTGECVLKLIAFHCDYFTSGWNIFDF
MVVVLSITGLLLPLMVGYYFVSPSLVQLILLSRIIHVLRPGKGPKVFHDLLLPLVLFLPA
LLNISLLIFLVMFVYAIFGMYNFAYVKKEAGINDVSNFETFGSSMLCLFQVTIFAGWDGM
LDAIFNSKWSDCDPDKINPGTQVRGDCGNPIVGIIYFVSYILISWLIIVNMYIVLVMEFV
NIASKKRAKTLSEYDFRKYFQVWKRFDPDGTQYIDSSKLSDFAAALDPPLYMAKPNKGQL
VAMDLPMAVGDRIHCLDILLAFTKRVVGKDVRIEKLLSEMESGFVLANPFKITYEPITTT
LKRKQEAVSATIIQRAYKSYRLRQSDKNTSDIHMIDDDREVQATKEDA
NT seq 5007 nt   +upstreamnt  +downstreamnt
atggtggcaagtgcaaaattgaaaatggcttccccagaacctaagggccttgtcgccttc
accaaggaatctcttgaacttatggaacagcgtattgctaaaaaacacaatgaagaacat
ggagaagaagatttaaagccaaaccctgacttggaagttggaaaagagcttccattcgtt
tacggaaatcttcctcgagggatggtgtcagagccattggaagatgtggacccatactac
cagaatcaaaatactttcatggtattaaataaaaagagaacaattttcagatttaatgcc
acctggtgtacactctcgcctttcaatttaattagaagaacagctgtgaagattttggtg
cacccattttttcgactgtttattttgattagtgtcctgattgactgcgtatttatgtcc
atgactaatttgccaaaatgggggccagaattacagatcactttgcttgcaatttacaca
tttgaaatacttgtaaaactcgttgcaagaggcatctggacaggatcttattatttcttt
ggtgatccatggaactggcttgacttcagtgtaactttgtttgagcatataacaatatat
tcacctctgaacttcatactaatatttagaattgcaagaagtttgagaattttgaaaatt
attcctttaaaccaaggtgtgaagtcttatgtagggaccctgctccaatgcgtgaagaaa
cttactggtgtcattatccttactctgttttttctgagcgtattttctctaattgggatg
gggctcttcatgggcaacctaaagcataaatgtctccgatggccccaagaaaatgaaact
gaaaccctgcacaacagaaccagaaacccaggttacattcgagaaacagaaaacttctat
tatttggaaggagaaagatatgctctcctttgtggcaacagaacagatgccggtcagtgt
cctgaaggatatgtgtgtgtaaaagctggcataaatcctgataatggctacacaaatttt
gacaatttcggctgggccttactagccctattccggttaatgacacaggatttccctgaa
gccctgtatcaccaggtcctttatgcttctggaaaggtctacatgatattttttattgta
ataagcttttggtttgccttttatatggcaagcttgttcttgggcatacttgctatgtcc
tatgaagaagaaaagcagacagctactgagaaagccaagaagatggatccaaaatttcag
cacactttacttcaagaagaaaatgaagcagctgagaccaagaccacacaaatagaaatg
aagaaaagattaccagtttctacacttgctcctttggatgtgttggatgctgctgctgtc
agtcatgaagaacataaaaattctcagaagagatgcccattgtgttggtataaatttgct
aaaattttcttgatctggaattgttctccctgttgggtaaaactgaaagagtttctccat
gtgattatgatgcacccatttactgatctttttctcactatgtgcataattctaaacata
tattttttggccatggaatattatccaatgagtgaggaaatcttcagtgttctcagcgtt
ggaaacctggtttttattggaatttttacaacagaaatgatttttaagataattgctatg
cacccatatgggtatttccaagtaggttggaacatttacgacagcctaattgtgctccat
ggtttagcagaactttttctagcaagtgttcatggactggctgttcttcaatcactcagg
gtgttaagaattttcaagctggggaaatactggccgacatttaagattctgctgctgact
cttacgaagtcattggtggccctgaaagacttgatcctgctgttgttcacgttcatgttc
ttttctgctattgttggcatgaggctgtttggtttgagataccaagaatatgcctgcaaa
ttagacaaagactgtcaactcccacgctggcacatgatcaacttcttccactcctacctg
aatgtgttccggattctctgtggagagtggatagagactttatgggattgctttgacata
gcaagccgattcagctgtattcctttttatatgatggtcattttaattggaaacttattg
atactttacctgtttctggcattggtgagcttcttcagttcatacaatgctgcaacggct
gaagagaatgatgaagccaaaaatctctggcgtgccctggcaaggattaagaaaggagta
agctatgtgctttctaaaatactatgtaaaagactagatggtcccaaggacacaatggac
catgaaaacaatcctcgtgctaaagagaacatttctgaccatactctttctgaattgagc
aacacccaagatttcaaggtcaaggaaagaagcactagcacagacaaaaacacaatgact
gaaaatgagagtcaatcacttatccccagtcctagtgtctctgaaactgtaccaattgct
tctggagaatctgatatagaaaatctggataacaaggagattcagagcaagtcaggttat
ggcagcagcaaagagaaggtaaagccatctagctcatctgaatgcagcacagttgatatt
gctctctctgaagaagaagaaatgatctatgaacatgaaaagccaaagcaccataaaaac
agttatgaacgaagatcttcaccaggtcaaatcagtagagactctaaaagaggaaaaatt
tggcgaaacataaggaaaacctgctgcaagatagtagaaaacagtttttttaagtgtttc
attggccttgtcactttgctcagcacaggtgctctggcttttgaagatatatatatcgat
caaagaaagaccattaaaatcttactagaatatgctgacatgatcttcacttacatcttt
atcctggaaatgcttctaaagtggatggcatatggtcttaaagcctatttcactaatggc
tggtacaggctagacttcatggttgttattgtattttgtcttaacttaatcggcaaatct
cgggaagagctaaagctactggcttccattaaattccttcgggcacttagagttctatct
caatttgaaagaatgaaggtggttgtgagagctttgataaaaacaactttacctgctttg
aatgtgtttttggtctgccttatgatttggctggcttttagcatcatgggagtatgctta
tttgctggcaagttctatcagtgcattgacccaacaagtggagaaaggtttcctacatat
gaagtcaggaataagaatcactgtgaaagtcttatactcaatgagtccatgccatgggag
aatgcaaagctgaactttgataatgttggaaatggttttctttcattgcttcaagtagca
acatttaatggatggatctctattatgaattcagctgttgattctactggtgtagatatg
cagcctgagtttgaaaagaacatctacatgtattgttactttctggtctttattgtcatt
ggattattcctccctctaactatgctgatcggtgttatccttgctaatttcaacaagcat
aaaataaagcaaggaggctcaaatatctttataacagaaaaacagaagaaacaatattgt
gcactgaagaagctgatgtgtgaaaactcgcaaaaaataatacctcgcccaggaaacaag
ttccaaagattcatctttgacttggtaacaagtcaagtttttaatattgtcattatggtt
cttatctgtctccaagcaataaccattatgatagaaagtgacggacagagttcacaaatg
gacactgctctcatctggattaacctagtttttgttatgctgtatactggagaatgtgtg
ctgaagctcattgctttccactgtgactatttcaccagtggatggaacatttttgatttt
atggtggtcgttctctctatcacaggactacttctgcctctgatggtagggtactacttt
gtatccccttcccttgtgcaactgatactcctctctcgaatcatccacgtcctgcgtcct
gggaagggcccgaaggtgttccatgacctgctgcttcctttggtgctcttcctcccagcg
ctgttgaacatcagtcttctcatcttcctggtcatgttcgtctatgccatctttggaatg
tacaattttgcctatgttaaaaaggaagctggaattaatgatgtgtccaactttgaaacc
tttggcagcagcatgctctgtcttttccaggttacaatatttgctggttgggatgggatg
ctcgatgcaatttttaacagtaagtggtcagactgtgatcctgataaaattaaccctggg
acccaggttagaggagattgtggtaaccccatcgttggaattatttattttgtcagttac
atcctcatatcatggctgatcattgtaaacatgtacattgttcttgttatggagtttgta
aatattgcttctaaaaaaagagccaagacgttgagtgaatatgattttaggaaatacttt
caggtgtggaagaggtttgatcctgatgggacccagtatatagactctagcaagctttca
gattttgcagctgctctggatcctcctctttacatggcaaaaccaaacaagggccagctt
gtcgccatggatcttccaatggctgttggggacagaattcactgccttgacatcttactt
gcttttacaaagcgagttgtgggtaaagatgtgaggatagagaaacttctttctgagatg
gaatcagggtttgtgttagccaacccttttaagatcacatatgagccaattacaactact
ctgaaacgcaaacaggaggcagtttcagcaaccatcattcagcgtgcttacaaaagttac
cgtttgaggcaaagtgacaaaaatacatcagatattcatatgatagatgatgacagggaa
gttcaagctaccaaagaagatgcttaa

KEGG   Miniopterus natalensis: 107530808
Entry
107530808         CDS       T05883                                 

Gene name
SCN4B
Definition
(RefSeq) sodium channel subunit beta-4
  KO
K04848  voltage-gated sodium channel type IV beta
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107530808 (SCN4B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107530808 (SCN4B)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107530808 (SCN4B)
SSDB
Motif
Pfam: V-set I-set Glycophorin_A Syndecan ig DUF368 Ig_3 DHHC
Other DBs
NCBI-GeneID: 107530808
NCBI-ProteinID: XP_016060209
LinkDB
Position
Unknown
AA seq 118 aa
MNNLSILLKDLEFSDTGRYTCHVKNPKEKDLQHQATIFLQVVDKLEEVDNTLTVIILAVV
GGVVGLLVFILLLKKLITFILKKTQEEKKECLVSSSGNDNTENGLPGSKAEEKPPAKV
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaacaacctttccatcctgctgaaggacctggagttcagcgacacgggcaggtacacc
tgccacgtgaagaaccccaaggagaaggacctccagcaccaggccaccatcttcctccaa
gtggtcgataaactggaggaagtggacaacacgctgacagtcatcatcctggccgtcgtg
ggcggggtcgtcgggctcctggtcttcatcctgctgctcaagaagctcatcaccttcatc
ctcaagaagactcaggaagagaagaaggagtgcctcgtaagctcctcagggaacgacaac
acggagaatgggctgccaggctccaaggccgaagagaaaccgccagccaaagtgtga

KEGG   Miniopterus natalensis: 107543440
Entry
107543440         CDS       T05883                                 

Gene name
SCN1B
Definition
(RefSeq) sodium channel subunit beta-1
  KO
K04845  voltage-gated sodium channel type I beta
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107543440 (SCN1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107543440 (SCN1B)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107543440 (SCN1B)
SSDB
Motif
Pfam: V-set Ig_3 ig
Other DBs
NCBI-GeneID: 107543440
NCBI-ProteinID: XP_016076457
LinkDB
Position
Unknown
AA seq 218 aa
MGTLLAFLVGTALVSSAWAGCVEVDSETEAVYGMAFKILCISCKRRSETTAETFTEWTFR
QKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTRDLQDLSIFITNVTYNHSGDYE
CHVYRLLFFENYEHNTTVVKKIHLEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMVY
CYKKIAAATEAAAQENASEYLAITSESKENCTGVQVAE
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggacactgctggctttcttggtcggcacggcgctggtgtcctcagcctgggcgggc
tgtgtggaggtggactcggagacggaggctgtgtacgggatggccttcaaaattctctgc
atctcctgcaagcgccgcagcgagaccaccgccgagaccttcacggagtggaccttccgc
cagaagggcactgaggagtttgtcaagatcctgcgctatgagaatgaggtgctgcagctg
gaggaagatgagcgttttgagggccgtgtggtttggaacggcagccggggcaccagggac
ctgcaggatctgtccatcttcatcacgaatgtcacctacaaccactcgggcgactacgag
tgccatgtctaccgcctgctcttcttcgagaactatgagcacaacaccactgtcgtaaaa
aagatccacctggaggtagtggacaaagccaacagagacatggcgtccatcgtgtctgag
atcatgatgtatgtgctcatcgtggtgttgaccatatggcttgtggcggagatggtttac
tgctacaagaagatcgctgctgccacggaggctgctgcacaggaaaatgcctcggaatac
ctggccatcacctcagaaagcaaagagaactgcacgggtgtccaggtggccgaatag

DBGET integrated database retrieval system