KEGG   Miniopterus natalensis: 107524307Help
Entry
107524307         CDS       T05883                                 

Definition
(RefSeq) MARVEL domain-containing protein 3-like
  KO
K21099  MARVEL domain-containing protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107524307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107524307
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107524307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_9_N CitMHS DUF1361 SIT
Motif
Other DBs
NCBI-GeneID: 107524307
NCBI-ProteinID: XP_016051671
LinkDB All DBs
Position
Unknown
AA seq 200 aa AA seqDB search
MVLMCIVASYFVLAGFSASFASGGGFGSNYYSPFEGTELEEVRQLDQQYTILRAPLIYGG
VAVSLGLGVLTMGVLLQGAKSLTKLPRNWLLLEAAFSVLAAVGYCTGVGVYLHVALRINA
TDTCKRRERLYARKGLTWMNCQLSGTDGAAATFACLLVIMYGVSVVLALRSYREQKHYKD
SREQHRNYSEAPEYLWSGTL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggttctcatgtgtatcgtggcttcctactttgtccttgctggattcagcgccagcttt
gccagtggcggcggctttggaagcaactattactcaccgtttgaaggcactgagctggag
gaggttcggcagctggaccagcagtacacaatcctccgggcacccctgatatacggtggc
gtggctgtttctctggggctgggtgtcctcaccatgggtgttttactccaaggagccaag
agtctaaccaaactgcccaggaactggctcctcctggaggccgccttcagcgtcctggca
gcagtgggctactgcacaggcgtcggggtttacctccacgtcgccttgcggatcaatgct
acagacacttgcaagagaagagaaaggctctatgcacgcaaaggtctcacctggatgaac
tgccagctgtcaggcactgacggagcggctgccacctttgcctgtcttctggtgataatg
tacggagtcagtgtggtgctggccctacggagctaccgagaacagaagcactacaaagac
agccgggaacagcacagaaattacagcgaagcaccggagtatctgtggtcaggaacactc
tga

DBGET integrated database retrieval system