KEGG   Miniopterus natalensis: 107524316
Entry
107524316         CDS       T05883                                 

Gene name
ABHD5
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase ABHD5
  KO
K13699  abhydrolase domain-containing protein 5 [EC:2.3.1.51]
Organism
mna  Miniopterus natalensis
Pathway
mna04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107524316 (ABHD5)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     107524316 (ABHD5)
Peptidases and inhibitors [BR:mna01002]
 Serine peptidases
  Family S33
   107524316 (ABHD5)
Lipid biosynthesis proteins [BR:mna01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   107524316 (ABHD5)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1071
Other DBs
NCBI-GeneID: 107524316
NCBI-ProteinID: XP_016051677
LinkDB
Position
Unknown
AA seq 365 aa
MGQSLGRAQKRGLQRNGARLSPEIPLLLDLKLSGWLTGWLPTWCPTSTSHLKEAEEKILK
CVPSIYKKEAVRISNGNKIWTLKFSHNISNKTPLVLLHGFGGGLGLWALNFEDLCTNRPV
YAFDLLGFGRSSRPMFDNDAEEVENQFVESIEEWRCALGLDKVILLGHNLGGFLAAAYSL
KYPSRVSHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAGPFGLSL
VQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKM
DPHIPVSVIYGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEDFNHKVKEI
CDTVD
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgggccagtccctgggaagggcacagaagagaggattacagagaaatggagccaggctt
agtcctgaaatccctcttcttctggacttaaagctgtcaggatggctaactggttggctt
cctacatggtgccctacgtctacatcacaccttaaagaagctgaagagaaaattttaaaa
tgtgtccccagcatatataaaaaagaagctgttcgtatatctaatggaaataaaatatgg
acactgaagttctctcacaatatttcaaataagactccacttgttctcctccatggattt
ggaggcggccttggactctgggcactgaattttgaagatctttgcaccaatagacccgtc
tatgcttttgaccttttgggctttggacgaagtagtagacccatgtttgacaatgatgcg
gaggaagtggagaatcagtttgtggaatccattgaagagtggaggtgtgctctcggactg
gacaaagtgatcttgcttggacacaacctgggtggattcttggctgctgcttactcactg
aagtacccatcaagggttagtcatctcattttagtggagccttggggtttccctgagcga
ccggacctggctgatcaagaccgaccgattccagtttggatcagagccttgggagcagca
ctgactccctttaaccctttagctggcctcaggattgcaggacccttcggtttaagtcta
gtacagcgtttgaggcctgatttcaaacggaagtactcttcaatgttcgaagatgatact
gtgacagaatacatctaccactgtaacgtgcagactccgagtggtgagacagcgttcaaa
aatatgactatcccttatggatgggcaaaaaggccaatgctccagcgaatcggcaagatg
gaccctcacattccagtctcggtgatctatggtgcccggtcctgcatagacggcaattcc
ggcaccagcatccagtcgttacgaccacattcatacgtgaagacgatagccatccttggg
gcagggcattatgtgtatgcagatcagcccgaagacttcaaccacaaagtgaaagagatc
tgtgacactgtggactga

DBGET integrated database retrieval system