KEGG   Miniopterus natalensis: 107524357
Entry
107524357         CDS       T05883                                 

Gene name
MYH11
Definition
(RefSeq) myosin-11
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107524357 (MYH11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107524357 (MYH11)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107524357 (MYH11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107524357 (MYH11)
   04147 Exosome [BR:mna04147]
    107524357 (MYH11)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107524357 (MYH11)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   107524357 (MYH11)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Crescentin CC2-LZ IQ ADIP AAA_22
Other DBs
NCBI-GeneID: 107524357
NCBI-ProteinID: XP_016051730
LinkDB
Position
Unknown
AA seq 1979 aa
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKKLVWIPSEKQGFEAASIKEEKGDEVIV
ELVENGKKVTVSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVINPYKQLPIYSEKIVEMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSLAYGELEKQLLQANPILEAFGNAKT
VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKD
KMKSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETLEAMGIMGFNEDEQLSILKVVSSV
LQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRAILTPRIKVGRDVVQKAQT
KEQADFAIEALAKATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQ
LCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLA
LLDEECWFPKATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLT
KNMDPLNDNVTALLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTV
GQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQ
GFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTG
VLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQ
WWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKAESELKELEQKHTQLAEEKNLLQ
EQLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQML
DLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDDILVMDDQNNKLSKERKLLEERISDLTT
NLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKNRQELEKLKRKLEGEASDFHEQIAD
LQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAA
RNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDDETRSHEAQ
VQEMRQKHTQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLNQAKQEVEHK
KKKLEVQLQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL
GSQLQDTQELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEIEAKQNLERHISTLNIQL
SDSKKKLQDFASTVEALEEGKKKFQKEIEGLTQQYEEKAAAYDKLEKTKTRLQQELDDLV
VDLDNQRQLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALE
EALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELED
ELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRA
LAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFA
TAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSVSGRNTLQDEKRR
LEARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLNNELATERSAAQKNESARQQLERQ
NKELRSKLQEMEGAVKSKFKSTIAALEAKIAQLEEQVELEAREKQAAAKSLKQKDKKLKE
VLLQVEDERKAAEQYKEQAEKGNAKVKQLKRQLEEAEEESQRINANRRKLQRELDEATES
NEAMGREVTALKSKLRRGNETSFVPSRRSGGRRVIENADGSDEEVDARDADFNGTKASE
NT seq 5940 nt   +upstreamnt  +downstreamnt
atggcgcagaagggccagctcagtgacgatgagaagttcctcttcgtggacaaaaacttc
atcaacagccccgtggcccaggcggactgggctgccaagaagctggtgtggatcccttcg
gagaagcagggcttcgaggcggccagcatcaaggaggagaagggcgacgaggtgatcgtg
gagctggtggagaatggcaagaaggtgacagtcagcaaagatgacatccagaagatgaac
ccgcccaagttctccaaggtggaggacatggcagagctcacgtgcctcaatgaagcctcc
gtgctgcacaacctgagggagaggtacttctcgggactcatctacacgtactccggcctc
ttctgcgtggtgatcaacccctacaagcaactgcccatctattcagagaagatcgtcgaa
atgtacaagggcaagaagagacatgagatgccgcctcacatctacgccatcgccgacacg
gcctaccgcagcatgctgcaagatcgagaggaccagtccatcctatgcacaggcgagtct
ggagctgggaagacggagaacaccaagaaagtcatccagtacctggccgtggtggcctcc
tcccacaagggcaagaaggacaccagcatcacgcaaggcccatctcttgcctacggagag
ctggaaaagcagcttctacaagcaaacccgattctggaggcttttggcaacgccaaaaca
gtcaagaacgacaactcctcgcgattcggcaagttcatccgcatcaactttgacgtcacc
ggttacattgtgggagccaacattgagacatatctgctggaaaagtcccgggcgattcgc
caggccagagacgagaggacgttccacatcttttactatatgattgctggagccaaggac
aagatgaaaagtgacctgcttttggagggcttcaacaactacaccttcctctcaaatggc
tttgtgcccatcccggccgcccaggacgacgagatgttccaggaaaccttggaggccatg
gggatcatgggcttcaatgaagacgagcagctgtccatcctgaaggtggtgtcgtccgtc
ctgcagctgggcaatatcgtcttcaagaaggagaggaacacggaccaggcgtccatgccg
gacaacacagctgctcagaaagtttgtcacctcatgggaattaatgtgacggatttcacc
agagccatccttaccccacgtatcaaagtagggcgggatgtggtacagaaagctcagaca
aaagaacaggcagactttgccatagaggctctggccaaggccacttacgagcgccttttc
cgctggatactcagccgtgtgaacaaagccctggacaagacccaccggcaaggggcttcg
ttcctaggaatcctggacattgctggatttgagatctttgaggtgaactccttcgagcag
ctgtgcatcaactacaccaacgagaagctgcagcagctcttcaaccacacgatgttcatc
ctggagcaggaggagtaccagcgcgagggcatcgagtggaacttcatcgacttcgggctg
gacctgcagccctgcatcgagctcatcgagcggccgaacaacccgccaggcgtgctcgcc
ctgctggacgaggagtgctggttccccaaagccacggacaagtcctttgtggagaagctg
tgctcggagcagggcaaccaccccaagtttcagaagcccaagcagctcaaggacaaaacg
gagttctccatcatccactatgccgggaaggtggactacaacgcgagtgcctggctgacc
aagaacatggacccgctgaatgacaacgtgactgccctcctcaacgcctcctcagacaag
tttgtggctgacctgtggaaggatgtggaccgcattgtggggctggaccagatggccaag
atgacagagagctcgctgcccagcgcctccaagactaagaagggcatgttccgcacggtg
gggcagctctacaaggagcagctggggaagctgatgaccacgctgcgcaacaccacgccc
aactttgtgcgctgcatcatccccaaccacgagaaaaggtccggcaagctggatgccttt
ctggtgctggagcagctacggtgcaacggggtgttagaaggcatccgtatctgccgccag
ggcttccccaacagaatcgtcttccaggagttccgccaacgctacgagatcctggccgcg
aacgccattcccaaaggcttcatggacgggaagcaggcctgcatcctcatgatcaaagcc
ctagagctcgaccccaacttgtacagaattgggcagagcaaaatcttcttccgaaccggg
gtcctggctcacctggaggaagagcgagacttgaagatcaccgatgtcatcatggctttc
caggccatgtgtcgtggctacctcgccagaaaagcctttgccaagaggcagcagcagctg
acggccatgaaggtgattcagaggaactgtgccgcctacctcaagctgcggaattggcag
tggtggaggctcttcaccaaggtgaagcccctgctgcaggtgacacggcaggaggaggag
atgcaggccaaggaggatgagctgcagaagaccaaggagcggcagcagaaggcagagagc
gagctcaaggagctggagcagaagcacacacagctggccgaggagaagaacctgctgcag
gagcagctgcaggcggagacggagctgtatgccgaggctgaggagatgcgggtccggctg
gcagccaagaagcaggaactggaggagatcctgcatgagatggaggcccgcctggaggag
gaggaggaccggggccagcagctgcaggcagaaaggaagaagatggcccagcagatgctg
gacctggaggaacagctggaggaggaggaagctgcaaggcagaagctacaacttgagaag
gtcacggctgaggccaagatcaagaaactggaggatgacatcctggtcatggatgatcag
aacaacaaactgtcaaaagagcgaaaactccttgaagagaggattagtgacttaacaacg
aatcttgcagaagaggaagaaaaggccaagaatctcaccaagctgaaaaacaagcacgaa
tctatgatttcagaactggaagtgcggctgaagaaggaggagaagaaccggcaggagctg
gagaagctgaaacggaagctggagggagaggccagcgacttccacgagcagatcgccgac
ctgcaggcgcagatcgccgagctgaagatgcagctggccaagaaggaggaggagctgcag
gcggccctggccaggcttgacgatgaaattgctcagaagaataacgccctgaagaagatc
cgggagctggagggtcacatctcagacctgcaagaggacctggactcagaacgggccgcg
agaaacaaagctgagaagcagaagcgagacctgggggaggagctggaggcgctgaagaca
gagctggaggacacgctggacagcacggccacccagcaggagcttcgggccaagagggag
caggaggtgacggtgctgaagaaggccctggacgatgagactcgatcccacgaggcccag
gtccaggagatgaggcagaagcacacccaggctgtggaggagctcaccgagcaactggag
cagttcaagagggccaaggccaacctggacaagaacaagcagactctggagaaggagaat
gcagacctggcgggtgagctgcgggtcctgaaccaggccaagcaggaggtggaacacaag
aagaagaagctggaggtgcagctgcaggagctgcagtccaagtgcagcgatggggagcgg
gcccgcgctgagctcaacgacaaggtccacaagctgcagaatgaagtagagagtgtcacg
gggatgctgaacgaggcggaaggaaaggccatcaaattggccaaggacgtggcgtccctg
gggtcccagctccaggacacacaggagctgcttcaagaagagacccggcagaagctcaac
gtgtccaccaagctgcgccagctcgaggatgagaggaacagcctacaggaccagctggat
gaggagatagaggccaagcagaacctggagcgtcacatctcaactctgaacatccagctc
tccgattcaaagaagaagctgcaggactttgccagcaccgtggaggccctggaagagggc
aagaagaagttccagaaggaaattgaaggcctcacccagcagtacgaagagaaggcagct
gcttatgacaaactggaaaagaccaagaccaggcttcagcaggagctggacgacctggtt
gtcgatttggacaaccagcggcaactggtgtccaacctggaaaagaagcagaagaagttt
gatcagttgttggcagaggagaaaaacatctcttccaaatatgcggatgagagggacaga
gccgaggcggaagctagggaaaaagaaaccaaggccttgtccctggcacgggcccttgag
gaggccttggaagccaaagaggaactcgagaggaccaacaaaatgctcaaagccgagatg
gaggacctggttagctccaaggatgatgtaggcaagaacgtccatgagctggagaagtcc
aagcgggccctggaaacccagatggaggagatgaagacccagctggaagagctggaggat
gagctgcaggcgacagaagatgccaagctgcggctggaggtcaacatgcaggccctcaaa
ggccagtttgagcgtgatctccaggcccgggatgagcagaatgaagagaagaggaggcag
ctccagaggcagctccacgagtatgagacagaactggaagacgaacgaaagcaacgtgcc
ctggctgctgcagccaagaagaagctggaaggagacctgaaagatctagagctgcaggcc
gactcggccattaaggggagggaggaagccatcaagcagctgcgcaaactgcaggctcag
atgaaggacttccagagagagctggaagatgcccgtgcctccagagacgaaatctttgcc
acggccaaggagaatgaaaagaaagccaagagtttagaagcagacctcatgcagctacag
gaggatctagccgcggctgagagggctcgcaaacaggcagacctggagaaggaggagctg
gcagaggagctggccagcagtgtgtcaggaaggaacacgcttcaggacgagaagcgccgc
ctggaggcccggattgcacagctggaggaggagctggaagaagagcaaggcaacatggag
gccatgagtgaccgtgtccggaaggccacacagcaggcggagcagctcaacaacgagctg
gccacggagcgcagcgcagcccagaagaacgagagcgcgcgacagcagctcgagcggcag
aacaaggagctccggagcaagctgcaggagatggagggggcggtgaagtccaagttcaag
tccaccatcgcggcgctggaggccaagatcgcacagctggaggagcaggttgagctggag
gccagagagaaacaggcggctgccaagtcactgaagcagaaggacaagaagctgaaggag
gtcctgctgcaggtggaagacgagcgcaaggcggctgagcagtacaaggagcaggcagag
aaaggaaacgcaaaggtcaaacaactcaagaggcagctggaggaggcagaggaggagtcc
cagcgcatcaacgccaaccgcaggaagctgcagcgggagctggacgaggccactgagagc
aacgaggccatgggccgagaggtgacagcactcaagagcaagctcaggcgaggaaacgag
acctcttttgttccctctagaaggtctggaggacgcagagttattgaaaacgcggatggt
tcagatgaggaagtggatgctcgagatgcagacttcaatggaaccaaagccagtgaatag

KEGG   Miniopterus natalensis: 107531785
Entry
107531785         CDS       T05883                                 

Gene name
MYH14
Definition
(RefSeq) myosin-14
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107531785 (MYH14)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107531785 (MYH14)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107531785 (MYH14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107531785 (MYH14)
   04147 Exosome [BR:mna04147]
    107531785 (MYH14)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107531785 (MYH14)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   107531785 (MYH14)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head ADIP IQ AAA_22
Other DBs
NCBI-GeneID: 107531785
NCBI-ProteinID: XP_016061422
LinkDB
Position
Unknown
AA seq 2006 aa
MAAVTMTVPGRKAPLRPGPVPEAAQPVPSELHGFEAAALRDEGEEEAEVELAESGRRLRL
PRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQL
PIYTEAIVEMYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKV
IQYLAHVASSPKGRKEPGVPASTSTMSYGELERQLLQANPILEAFGNAKTVKNDNSSRFG
KFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECSFHIFYQLLDGAGEQLKADLLLEP
CSHYRFLTNGPASSPGQERELFQETLESLRVLGFTHEEITSMLRMVSAVLQFGNIVLKRE
RNTDQASMPDNTAAQKLCRLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEAL
AKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQ
QLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKA
TDKSFVEKVAQEQGGHPKFQRPRNLRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDSVA
ALLHQSTDRLTAEIWKDEQGGFQQFSFLGSFPPSPPGSSGRLSSATSPPGVEGIVGLEQV
SSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPK
LVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQA
LELDPNLYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQKRQQQQ
SALRVMQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAR
EVGELQSRLAQVEEERTRLAEQLRAEAELCAEAEETRERLAARKQELELVVSELEARVGE
EEECSRQLQNEKKRLQQHIQELETHLEAEEGARQKLQLEKVTTEAKLKKFEEDLLLLEDQ
NAKLSKERRLLEERLAESSAQAAAEEEKLKSLSKLRLRYEAAIADLEDRLRKEEKGRQEL
EKLKRRLDGESSELQEQMVEQQQRVEELRAQLGRKEEELQAALLRVEEEGGARAQLLKSL
REAQAGLSEAQEDLEAERAARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKRE
QEVTELKKALEEETRVHELAVQELRQRHGQALGELAEQLEQARRGKGVWEKTRLALETEV
SELRAELSNLQATRQEGEQRRRRLESQLQEVQGRAGDGERARAEAAEKLQRAQAELENVS
GALSEAESRAIRLSKELSSTEAQLHDAQELLQEETRTKLALGSRARALEAEVAGLREQLE
EEAAARERAGRELQTAQVQLSEWRRRQEEEAGALEAGEEARRRAAREAEVLMQRLTEKTE
VVERLERGRRRLQQELDDATMDLEQQRQLVSTLEKKQRKFDQLLAEEKAAVLRAVEERER
VEAEGREREARALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKSVHELERA
RRVAEQAANDLRTQVTELEDELTSAEDAKLRLEVTVQALKAQHERDLQGRDEAGEERRRQ
LAKQLRDAELERDEERKQRALAVAARKKLEAELEELKAQTSAAGQGKEEAVKQLRKMQAQ
MKELWREVEESRTSREEIFAQNRESDKRLKGLEAEVLRLQEELAASDRARRQAQQERDEM
ADEVANGSLSKAAILDEKRQLEGRLGQMEEELEEEQSNAELLGDRYRKLLLQVESLTTEL
SAERSFSAKAESGRQQLERQIQELRGRLGEEDAGARARQKMTIAALESKLAQAEEQLEQE
SRERILSGKLVRRAEKRLKEVVLQVEEERRVADQLRDQLEKGNLRVKQLKRQLEEAEEEA
SRAQAGRRRLQRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASD
EEAEEAEPGSGQQPLEPDGSPEAQPQ
NT seq 6021 nt   +upstreamnt  +downstreamnt
atggcagcagtgaccatgaccgtgcccgggcggaaggcgcccctcaggccgggcccggtg
cccgaggcggcccagccggtgccgtcggagctgcacgggttcgaggcggcggcgctgcgc
gacgagggcgaggaggaggcggaggtggagctggcggagagcgggcggcggctgcggctg
ccgcgggaccagatccagcgcatgaacccgcccaagttcagcaaggccgaggacatggcc
gagctgacctgcctgaacgaggcctcggtgctgcacaacctccgcgagcgctactactcc
ggcctcatctacacctactctggcctcttctgtgtggtcatcaacccctacaagcagctg
cccatctacacggaggcgattgtggagatgtaccggggcaagaagcgccacgaagtgccg
ccccacgtgtacgccgtgaccgagggcgcctacaggagcatgctccaggatcgtgaggat
cagtccatcctctgcaccggggagtcgggagcagggaagacagaaaacaccaagaaggtc
attcagtatctcgcccatgtggcatcatcaccgaagggcaggaaggaaccgggcgtaccc
gcctccaccagcaccatgtcttatggtgagctggagcggcagcttcttcaggctaacccc
atcctggaggccttcggcaatgccaagacggttaagaatgacaactcctcccgatttggc
aagttcatccgcatcaactttgacgtcgccgggtacatcgtgggcgccaacatcgagacc
tacctgctggagaagtctcgggccatccgccaggccaaggacgagtgcagcttccacatc
ttctaccagctgctggacggcgcgggcgagcagctcaaggccgacctgctcctggagccc
tgctcccactaccgcttcctcaccaatgggccggcgtcctctccgggccaggagcgggag
ctcttccaggagaccctggagtccctgcgggtcctggggttcacccacgaggaaatcacc
tccatgctgcggatggtctcggcggttctccagtttggcaacatcgtcctgaagcgagaa
cgaaacaccgatcaggcctccatgcctgacaacacagctgcccagaagctctgccgcctg
ctgggactgggggtgacggatttctcccgtgccctgctcaccccgcgcatcaaagttggc
cgagactatgtgcagaaagcgcagaccaaggagcaggctgacttcgctctggaggccttg
gccaaggccacctatgagcgcctcttccgctggctggtcctgcgcctcaaccgagccctg
gaccgcagcccccgccagggcgcctccttcctgggcatcttggacatcgccggcttcgag
atcttccagctgaactccttcgagcagctgtgcatcaactacaccaacgagaagctgcag
cagctcttcaaccacaccatgttcgtgctggagcaggaggagtaccagcgcgagggcatc
ccctggaccttcctggacttcggcctcgacctgcagccctgcatcgacctcatcgagcgg
ccggccaacccccctggactcctggccctgctggacgaggagtgctggttcccgaaggcc
acggacaagtcctttgtggagaaggtggcccaggaacagggtggccaccccaagttccag
cggccgaggaacctgcgggaccaggccgacttcagcgtcttgcactatgcgggcaaggtc
gactacaaggccaatgagtggctcatgaaaaacatggatcctctgaatgacagcgtcgca
gccctgctgcaccagagcacagatcggctgacagcagagatctggaaagatgaacagggg
ggcttccagcaattctctttccttggctccttcccaccatcacccccaggatcttcaggg
aggctcagctctgccacttctccgccaggggtggagggcatcgtggggctggagcaggtg
agcagcctcggggatggcccaccaggtggccgcccccgccggggtatgttccggacagtg
ggacagctctacaaggagtccctgagccgcctgatggccacactcagcaacaccaacccc
agctttgtccgctgtatcgtccccaaccatgagaagagggccgggaagctggagcccaag
ctggtgctggaccagctgcgctgcaacggcgtcctcgagggcatccgcatctgtcgccag
ggcttccctaaccgcatcctgttccaagagttccggcagcggtatgagatcctgaccccc
aatgccatccccaagggcttcatggatgggaagcaggcctgtgagaagatgatccaggcc
ctagaactggatcccaacctctaccgcgtgggacagagtaagattttcttccgggccggg
gtcctggcccagctggaagaggagcgggacctgaaggtgacagacatcatcgtgtccttc
caggcagctgcccggggatacctggctcgcagggccttccagaagcggcagcagcagcag
agcgcgctgagggtgatgcagcggaactgtgcggcctacctcaagctcagacactggcag
tggtggcggctcttcaccaaggtgaagccgctgctgcaggtgacgcggcaggacgaggtg
ctacaggcccgggctcaggagctgcagaaagtgcaggagctccagcagcagagtgcccgc
gaggtgggcgagctccagagccgcttggcacaggtggaagaggagcgcacccgcctggca
gagcagcttcgagcagaggctgagctgtgtgctgaggccgaggagacccgggagcggctg
gcggcccgtaagcaggagctggagctggtggtgtcggagctggaggcccgcgtgggggag
gaggaggagtgcagccgccagctgcaaaatgagaagaagaggctgcagcaacatatacag
gagctggagacccacctcgaggccgaggagggggcccggcagaagctgcagctggagaag
gtgacgacggaggcaaagctgaagaagttcgaggaggacttgctgctcctggaggaccag
aacgccaagctcagcaaggagcggcggctgctggaggagcggctggcggagtcctcggcg
caggcggcggccgaggaggagaagctcaagagcctgagcaagctgcgtctgcggtacgag
gcggccatcgctgacctggaggaccgcctacggaaggaggagaagggccgccaggagctg
gagaagctgaagcggcggctggacggcgagagctcggagctgcaggagcagatggtggag
cagcagcagcgggtggaggagctgcgggcccagctgggccgcaaggaagaggagctgcag
gccgccttgctgagggtggaggaggagggtggcgcccgggcccagctgctcaaatccctg
cgggaggcacaagctggactgtctgaggcccaggaagacctggaggctgagcgcgcggcc
agggccaaggccgagaagcagcggcgggacttgggcgaggagctggaggccctgcggggc
gagctggaggacacactggactccaccaatgcgcagcaggagctccggtccaagagggaa
caggaggtgacggagctgaagaaggctctggaggaggagacccgtgttcacgagctggct
gtgcaggagctgaggcagcgccatggccaggctctgggagagctggcggaacagctggag
caggcccggaggggcaaaggtgtgtgggagaagacccgtttggctctggagactgaggtg
tccgagctacgcgcggagctgagcaacctgcaggccacacgtcaggagggcgagcagcgg
aggcgccgcctggagtcacagctccaggaggtgcagggccgggccggagatggggagcgg
gcacgagctgaggctgccgagaagctgcagcgagcccaggctgaactcgagaatgtgtct
ggggcactgagtgaggccgagtccagagccatcaggctgagcaaggagctgagcagcacg
gaggcccagctgcatgacgcccaggagctgctgcaggaggaaaccaggacgaagctggcc
ttggggtcccgggcgcgagccttggaggcggaggtggcggggctgcgggagcagttggag
gaggaggcggccgccagggagcgggcaggccgtgagctgcagaccgcccaggtgcagctc
tcagagtggcggaggcgccaggaggaggaggctggagcactggaggcaggggaggaagct
cgtcgccgggcagcccgcgaggctgaggtcctgatgcagcgcctgacagaaaagacggaa
gtggtggagcggctggagaggggccgccggcggctgcagcaggagctggacgatgctacc
atggacctggagcaacagcggcagctcgtgagcacactggagaagaagcagcgcaaattc
gaccagctcctggcagaggagaaggcagctgtgctgcgggcagtggaggaacgtgagcgg
gttgaggccgagggccgggagcgcgaggctcgggccctgtcactgacccgggcgctggag
gaggagcaagaggcccgtgaggagctggagcggcagaaccgcgccctgcgggcagagctg
gaggcgctgctgagcagcaaggatgatgtcggcaagagcgtacatgagctggagcgagcc
cgccgggtggcagaacaggcagccaatgacctgcggactcaggtgacagagctggaggat
gagctgacatcagccgaggatgccaagctgcgcctggaagtgaccgtgcaggccctcaag
gcacagcacgagcgagacctgcagggccgagatgaggctggggaggagaggcggcggcag
ctggccaagcagctgcgggatgcagagttggagcgagacgaggagcgcaaacagcgcgcc
ctggcggtggccgcccgcaagaagctggaggcggagctggaggagctgaaggctcagacc
tcggcggcggggcagggcaaggaggaggcggtgaagcagcttcgcaagatgcaggcccag
atgaaggagctgtggcgggaggtggaggagtcacgcacctcccgggaggagatctttgcc
cagaaccgggagagtgacaagcgcctcaaagggcttgaggcagaggtgctgcggctgcag
gaggagctggccgcttcagaccgcgcccggcggcaggcccagcaggaacgggacgagatg
gccgatgaggtggccaacggcagcctgagcaaggcagccatcctggacgagaagcgccag
ctggaggggcgcctgggccagatggaagaggagctggaggaggagcagagcaacgcggag
ctgctcggcgaccgctaccgcaagctgctcctgcaggtggaatcactgaccacagagttg
tcagctgagcgcagtttctcagccaaggcagagagtggccggcagcaactggagcggcag
atccaagagctccgggggcgcctgggcgaggaggacgctggggcccgggcccgccagaag
atgaccattgctgcccttgagtcgaagctggcccaggctgaggagcagctggagcaggag
agcagggagcgcatcctctctggcaagctggtgcgcagagctgagaagcggcttaaagag
gtggtgctccaggtggaggaggagcggagggtggccgaccagctcagggaccagctggaa
aaggggaaccttcgagtgaagcagctgaagcgacagctagaggaggctgaggaagaggca
tctagggctcaggcaggtcgtcgaaggctgcagcgggagctggaggatgtcacagagtct
gctgagtccatgaaccgcgaagtgaccacattgaggaaccggctccgacgaggacccctc
accttcaccacccgcaccgtgcgccaggtgttccgactggaggagggtgtggcatcagac
gaggaggccgaggaggccgagcctggatctggacagcagcccctggagcctgacgggtcc
ccagaagcacagccccagtga

KEGG   Miniopterus natalensis: 107544543
Entry
107544543         CDS       T05883                                 

Gene name
MYH10
Definition
(RefSeq) myosin-10
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107544543 (MYH10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107544543 (MYH10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107544543 (MYH10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107544543 (MYH10)
   04147 Exosome [BR:mna04147]
    107544543 (MYH10)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107544543 (MYH10)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   107544543 (MYH10)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ CC2-LZ ADIP Crescentin AAA_22
Other DBs
NCBI-GeneID: 107544543
NCBI-ProteinID: XP_016077933
LinkDB
Position
Unknown
AA seq 1976 aa
MAQRSGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLD
EEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEE
KAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDE
LKVQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQ
KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEVQIQDMRQR
HASALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ
VQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGIKFSKDAASLESQLQDT
QELLQEETRQKLNLSSRIRQLEEERNSLQEQQEEEEEARKNLEKQVLALQSQLTDTKKKV
DDDLGTIESLEEAKKKLLKDVEALGQRLEEKALAYDKLEKTKNRLQQELDDLLVDLDHQR
QIVSNLEKKQKKFDQLLAEEKTVSARCAEERDRAEAEARERETKALSLARALEEALEAKE
EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATED
AKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKK
KMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK
KLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQ
LEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAK
LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVED
ERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSRE
VSTLKNRLRRGGPISFSSSRSGRRQLHIEGASLELSDDDTESKTSDVNETQPPQSE
NT seq 5931 nt   +upstreamnt  +downstreamnt
atggcacagagaagtggacttgaagatccagagaggtatctctttgtggacagggctgtc
atctacaaccctgccacacaggctgattggacggcgaaaaagctagtgtggattccatca
gaacgccatggttttgaggcagctagtatcaaagaggagcggggcgatgaggttatggtg
gagttggcagagaacggaaagaaagcgatggtcaacaaagatgatatccagaagatgaac
ccacctaagttttccaaggtggaggatatggcagaattgacgtgcttgaacgaagcttct
gttttacataatctgaaggatcgttactattcaggactcatctatacgtattctggactc
ttctgtgtagtgataaatccttacaagaatcttccgatttactctgagaatattattgaa
atgtacagagggaagaaacgtcacgagatgcctccacatatctatgctatatctgagtct
gcctacagatgcatgcttcaagatcgtgaggatcagtcaattctttgcacgggtgaatcg
ggtgccgggaagacagagaacactaagaaagtcattcagtaccttgctcatgttgcttct
tcacataagggacgaaaggaccacaatattcctggggaacttgaacggcagcttttgcaa
gccaatccaattctggaatcatttggaaatgcgaagactgtgaaaaatgataactcatct
cgttttggcaagtttattaggatcaactttgatgtaactggctatatcgtgggggccaac
attgaaacataccttctggaaaaatctcgtgctgttcgtcaagcaaaagatgagcgtact
tttcatatcttttaccagctgttatctggagcaggagaacacctaaagtctgatttgctt
cttgagggatttaacaactacagatttctctccaatggctatattcctattccggggcag
caagacaaagataacttccaggagacgatggaagcaatgcacataatgggcttctctcat
gaagagattctgtcaatgcttaaagtagtatcttcagtgcttcagtttggaaatatttct
ttcaaaaaggagcgaaacactgatcaagcttctatgccggaaaatacagtcgcacagaag
ctctgccaccttcttggcatgaatgtgatggagtttacgcgggctatccttaccccccgg
atcaaggtcggccgagactacgtgcagaaagcccagaccaaagaacaggcagactttgca
gtggaagcattagcaaaagctacctatgagcggctctttcgctggctcgttcaccgtatc
aataaagctctggatcggaccaaacgtcagggagcatctttcattggaatcctggatatt
gctggatttgagatatttgagctgaactcctttgagcagctctgcatcaactacaccaac
gagaagctgcagcagctcttcaaccacaccatgttcatcctggagcaggaggagtaccag
cgcgagggcatcgagtggaacttcatcgacttcgggctcgacctgcagccctgcattgac
ctcatcgagaggcctgccaaccctcctggtgtacttgcccttttggatgaagagtgctgg
ttccctaaagctacagataaaacctttgttgaaaaactagttcaagagcaaggttcccac
tccaagtttcagaagcctcggcaactgaaagacaaagctgatttttgcattatacattat
gcagggaaggtggactacaaggcagacgagtggctgatgaagaatatggaccccctcaac
gacaacgtggccacgctcctgcaccagtcctcagacagatttgttgccgagctgtggaag
gatgtggatcggattgtgggtctggatcaagttacgggtatgactgagacggcttttggc
tctgcgtataagaccaaaaagggcatgtttcgtaccgttgggcaactctacaaagagtct
ctcaccaagctgatggcaactctccgcaacaccaaccctaactttgttcgctgcatcatt
ccaaatcacgagaagcgggctggaaaactggacccgcacctagtgctggaccagcttcgc
tgcaatggtgtcctggaaggcatcagaatctgtcgccaggggttccccaaccggatagtt
ttccaggaattcagacagagatacgagatcctaactccaaatgctatccctaaaggtttt
atggatggcaaacaggcttgtgagcgaatgatccgggctttagaattggacccaaacttg
tacagaattggacagagcaagatatttttccgagctggagttctggcacatttagaggaa
gaaagggatttaaaaatcaccgatatcattatcttcttccaggctgtgtgcagaggctac
ctggccagaaaggcctttgccaagaagcagcaacaactcagtgccttaaaggtcctacag
cggaactgcgccgcctacctgaagctgcggcactggcagtggtggcgcgtcttcacaaag
gttaagccgctcctacaagtcactcgccaagaggaagaacttcaggccaaagatgaagag
ctgctgaaggtgaaggagaagcagacaaaggtggagggggagctcgaggaaatggagagg
aagcaccagcagctcttggaggagaagaacatccttgcagagcagctacaggcagagacg
gagctgtttgctgaggcagaagaaatgagagcgagactcgctgccaagaagcaggaatta
gaggagattctacatgacttggagtctagggttgaagaagaggaggaaagaaaccagatc
ctccaaaatgaaaagaaaaaaatgcaagcacatatccaggacctggaggagcagctggac
gaggaggagggggctcggcagaagctgcagctggagaaggtgacggccgaggccaagatc
aagaagatggaggaggagatcctgctgctggaggaccagaactccaagttcatcaaagaa
aagaaactcatggaagatcgcattgctgagtgttcctctcagctggctgaagaggaagaa
aaggcaaagaacttggccaaaatcaggaataagcaagaagtgatgatctcggatttagaa
gaacgcttaaagaaggaagagaaaacccgccaggaactggaaaaggccaagaggaagctg
gacggtgaaacgactgacctgcaggatcagatcgcggagctgcaggcccagatcgacgag
ctcaaggtgcagttggccaagaaggaggaggagctgcagggcgccctggccaggggtgac
gacgaaacactccataagaacaatgcacttaaagtcgtgcgagagctgcaagcacaaatt
gctgagcttcaagaagactttgaatctgagaaggcttcgcggaacaaggcagaaaagcag
aaaagggacttgagtgaggaactggaagctctgaaaaccgagctggaggacactctggac
accaccgccgctcagcaggaactccgcacgaaacgtgaacaagaagtggcagagctgaag
aaggctcttgaggaagaaactaagaaccatgaagtgcaaatccaggacatgaggcagagg
cacgcatcggccctggaagagctctcggagcagctggaacaggcgaaaaggttcaaagca
aatctggagaagaacaagcagggccttgagaccgacaacaaggagctggcgtgtgaggtg
aaggtgctgcagcaggtcaaggctgagtctgagcacaagaggaaaaaactcgatgcccag
gtccaggagctccacgccaaggtctcggagggggaccggctccgcgtggaactggctgag
aaggctaataaactacagaatgagctggataatgtctcgactcttctggaagaagcagag
aagaagggtattaagttttctaaggatgcagctagtcttgagtctcaactacaggataca
caggagctcctccaggaggaaacacgccagaagctgaacctgagcagccgaatccggcag
ctggaggaggagaggaacagcctccaggagcagcaggaggaggaggaggaggcccggaag
aacctggagaaacaggtgctggccctgcagtcccagttgactgatacaaagaagaaagta
gatgatgacttgggaacaattgaaagtttggaagaagccaaaaagaagcttcttaaagac
gtggaagcactgggccagcgcctggaggaaaaggctttggcctatgacaagctggagaag
accaagaaccgcctgcagcaggagctggacgacctgctggtggacctggaccatcagcgc
cagatcgtctccaatttggagaagaagcagaagaaatttgaccagctgttggcagaagag
aagaccgtctctgctcgctgtgcggaagagcgagaccgagctgaagcagaggccagagag
agagaaaccaaagctctgtccctggcccgggcccttgaggaggccctggaggccaaggag
gagtttgagaggcagaacaagcagctccgggcagacatggaggatctgatgagctccaaa
gatgacgtggggaaaaacgttcatgaacttgaaaaatccaaacgggccctcgagcagcag
gtagaggaaatgaggacccagctggaagagctggaggatgaacttcaggcaacagaagat
gccaagctgcgcctggaggtcaacatgcaggccatgaaggcccagttcgagagagacttg
caaaccagagatgaacagaatgaagaaaagaagcggctgctgattaaacaggtgcgggag
cttgaggcagagctagaggatgagcggaaacagcgcgcgcttgctgttgcttcaaagaag
aaaatggaaatagatttgaaggaccttgaagctcaaattgaggctgcaaacaaagcgagg
gatgaagtcatcaagcagctgcgtaaacttcaggctcagatgaaggattaccagcgtgaa
ttagaagaagcccgtgcatcccgggatgagatttttgctcaatccaaagagagtgaaaag
aaattaaagagtctggaagcagaaatccttcagctacaggaggaacttgcctcatcggag
cgagcccgccgacatgctgagcaagagagagatgagctggctgatgagatcgccaacagc
gcctctggcaagtctgcgctgctggatgagaagcggcgtctggaggcacggatcgcacag
ctagaggaggagctcgaagaggagcagagcaacatggagctgctcaacgaccgcttccgc
aagaccacgctacaggtggacacattgaatgcagagctggcggccgagcgcagtgctgcc
cagaagagcgacaatgcgcgccagcagctagagcggcagaacaaggagctgaaggccaag
ctgcaggagctagagggtgctgtcaagtccaagttcaaggccaccatctcagccctcgag
gccaagattgggcagctggaggagcaactggagcaggaggccaaggaacgagcagcagcc
aacaaactggtccgacgtaccgagaagaaactgaaagaaatcttcatgcaggttgaagat
gaacgtcgccatgcagatcagtataaagaacagatggagaaggccaatgcccggatgaag
caacttaaacggcagctggaggaagcagaagaagaagctacacgtgccaatgcatctcgg
cgtaaactccagcgggaactggatgatgccactgaggccaacgagggtctgagccgtgag
gtcagcaccctgaagaaccggctgaggcgaggtggcccaatcagcttctcttcgagcaga
tctggccggcgccagctgcatattgaaggggcttccctggagctgtcagacgatgacacc
gaaagtaagaccagtgatgtcaatgagacgcagccgccccagtcggagtag

KEGG   Miniopterus natalensis: 107544784
Entry
107544784         CDS       T05883                                 

Gene name
MYH9
Definition
(RefSeq) myosin-9
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107544784 (MYH9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107544784 (MYH9)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107544784 (MYH9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107544784 (MYH9)
   04147 Exosome [BR:mna04147]
    107544784 (MYH9)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107544784 (MYH9)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   107544784 (MYH9)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Crescentin IQ CC2-LZ ADIP AAA_22
Other DBs
NCBI-GeneID: 107544784
NCBI-ProteinID: XP_016078195
LinkDB
Position
Unknown
AA seq 1960 aa
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGDEAVVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDSAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDLFQETMEAMRIMSIPEEEQVGLLRVISGVLQLGNIAFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQIAELQAQIAELKMQLAK
KEEEVQAALARVEEEATQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEDEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLTQSDSKSSKLTKDFSTLESQLQDTQELLQEE
NRQKLSLSTKLKQVEDEKNSLKEQLEEEEEAKRNLEKQISTLHAQVTDMKKKMEDGVGCL
ETAEEAKRKLQKDLEGLSQRYEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTVSAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSLAVAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDYMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELVNDRLKKANLQIDQINTDLNLERSHAQKNENARQQMERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKLKDVLLQVDDERRNAEQ
FKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGTGECSDDEVDGKADGAEAKAAE
NT seq 5883 nt   +upstreamnt  +downstreamnt
atggcgcagcaagcggctgataagtatctctatgtggataagaacttcatcaataacccc
ttggcccaggccgactgggctgccaagaagctggtctgggtgccgtctgacaagagtggc
tttgagcctgccagcctcaaggaagaggtgggcgatgaggccgtggtggagctggtggag
aacgggaagaaggtgaaggtgaacaaggatgacatccagaagatgaacccacccaagttc
tccaaggtggaggacatggcggagctcacgtgcctcaacgaagcctcggtgttgcacaac
ctcaaggagcgctactactcagggctcatctatacctattcaggcctgttctgtgtggtc
atcaatccttataagaacctgcccatctactctgaagagattgtggaaatgtataaaggc
aagaagaggcatgagatgccccctcacatctatgccatcacagactccgcctacaggagc
atgatgcaagaccgagaggaccagtccattttgtgcacgggtgagtctggagctggcaag
acagagaacaccaagaaagtcattcagtatctggctcacgtggcctcctcacataagagc
aagaaggaccagggcgagctggaacggcagctgctgcaggccaaccccatcctggaggcc
tttgggaacgccaagacagtgaagaatgacaactcctcacgatttggcaaattcattcgc
atcaactttgatgtcaatggctacatcgtgggagccaatattgagacttatcttttggag
aaatctcgtgctattcgtcaagccaaggacgagaggaccttccacatcttctactatctc
ctgtctggggctggagagcacctgaagactgacctcctgttggagccatacaacaaatac
cgcttcctgtccaatgggcatgtcaccattcctggtcagcaggacaaggacctgttccag
gagaccatggaggcgatgaggattatgagcatcccagaggaggagcaagttggtttgctg
cgggtcatctcgggggttcttcagcttggcaacatcgccttcaagaaggagcgtaacact
gaccaggcatccatgcccgacaacacagctgcccaaaaagtgtcccacctcttgggtatc
aatgtgactgatttcaccagaggaatcctcacccctcgaatcaaggtgggacgggattac
gtccagaaggcacagacaaaggaacaggctgactttgccatcgaggctttggccaaggcc
acctacgagcgcatgttccgctggctggtgctgcgcatcaacaaggccctggacaagacc
aagcggcagggcgcctcgttcatcgggatcctggacattgctggcttcgagatctttgat
ctgaactccttcgagcagctctgcatcaactacaccaacgagaagctgcagcagctcttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgcgagggcatcgagtggaac
ttcatcgactttgggcttgacctgcagccctgcattgacctcattgagaagccagcaggt
ccccctggcatcctcgccctgctggatgaggagtgctggttccccaaagccactgacaag
agcttcgtggagaaggtggtacaggagcagggcacccaccccaagttccagaagcccaag
cagctgaaggacaaagctgatttctgcatcatccactatgctggcaaggtggattacaaa
gctgacgagtggctgatgaagaacatggaccccctgaacgacaacatcgccacacttctg
caccagtcctccgacaagttcgtctcagagctgtggaaggatgtggaccgcatcattggc
ctggaccaggtagctggcatgtcggagacggcgctgcccggggccttcaagacgaggaag
ggcatgttccgcaccgtgggacagctctacaaggagcagctggccaagctgatggccaca
ctgagaaataccaaccccaacttcgtccgctgcatcatccccaaccatgagaagaaggct
ggcaaactggatccccatctggtgctggaccagctgcgctgcaacggggttcttgagggc
attcggatttgccgccagggcttccccaaccgggtggtctttcaggagttccggcagaga
tatgaaatcctgacaccaaactccatccctaagggcttcatggatgggaagcaggcgtgt
gtgcttatgatcaaagccttggagctcgacagcaacctgtaccgcatcggccagagcaag
gtcttcttccgggccggcgtgttggcccacctggaggaggagagggacctgaagatcacc
gatgtcatcattgggttccaggcctgctgcaggggctacctggccagaaaggcctttgcc
aagcggcagcagcagctgacagccatgaaggtcctacagaggaactgcgctgcctacctc
aagctgaggaactggcagtggtggcggcttttcaccaaggtcaagccgctgctgcaggtg
agccgccaggaagaggagatgatggccaaggaggaggagctggtgaaggtccgagagaag
cagctggctgcagagaacaggctcacggagatggagaccctccagtcccagctcatggca
gagaagttgcagctgcaggagcagctccaggcggaaacagaactgtgtgctgaagccgag
gagctccgggcccgcctgactgccaagaagcaggagctggaggagatttgccatgacctt
gaggccagggtggaggaagaggaggagcgctgccagcacctgcaggcagagaagaagaaa
atgcagcaaaacatccaggaactggaggagcagctggaggaggaggagagtgcccgccag
aagctgcagctggagaaggtgaccactgaggccaagctgaagaagctggaggaagaccag
atcatcttggaagatcagaactgcaagctggccaaggagaagaagctgttggaagacaga
atagccgagttcaccaccaacctcacggaagaggaggagaagtcgaagagcctcgccaag
ctcaagaacaaacacgaggccatgatcactgacctggaggagcgcctccgaagagaggag
aagcagcgtcaggagctggagaagacccgccggaagctggagggagactccacggacctc
aatgaccagatcgctgagctccaggctcagattgccgagctcaagatgcagctggccaag
aaagaggaggaggtccaggctgccctggccagagtggaggaggaagccacccagaaaaac
atggccctaaagaagatccgtgagctggaatctcagatctctgaacttcaggaagacctg
gagtctgagcgtgcttctcggaataaagctgagaagcagaaacgggaccttggggaagag
ctagaggctctaaaaacagagttggaggacaccctggattctacggctgcccagcaggag
ctcaggtccaaacgtgaacaggaagtgaatatcctgaagaagaccctcgaggatgaggcc
aagactcacgaggcccagatccaggagatgaggcagaagcactcacaggctgtggaggag
ctggctgagcagctggagcagacaaagcgggtaaaagccaaccttgagaaggccaagcag
accctggagaatgagcgaggtgagctggccaacgaggtgaaggccctgctgcagggcaaa
ggggactcagagcacaagcggaagaaagtggaggcccagctccaggagctgcaggtgaag
ttcaacgagggagagcgagtgcgcacggagctggccgacaaggtcaccaagctgcaggtc
gagctggacaatgtgacaggtcttctcacccagtctgacagcaagtccagcaagctcacc
aaggacttctccactctggagtcccagctgcaggacacacaggagctgctgcaggaggag
aaccggcagaagctgagcctgagcaccaagctgaagcaggtggaagacgagaagaactcc
ctcaaggagcagctggaggaggaggaggaggccaagaggaacctggaaaagcagatttcc
accctccacgcccaggtgaccgacatgaagaagaagatggaggatggcgtgggttgcctg
gagactgccgaggaagccaagaggaagctccagaaggacctggagggactgagccagcgc
tacgaggagaaggtggccgcctacgacaagctagagaagaccaagacgcggctacagcag
gagctggacgacctgctcgtggacctggaccaccagcggcagagtgtctccaacctggag
aagaagcagaagaagtttgaccagctcctggctgaggagaaaaccgtctctgccaagtat
gcggaggagcgcgaccgggctgaggcggaggcccgtgagaaggagaccaaggcgctttcg
ctggcccgggccctggaggaggccatggagcagaaggctgagctggagcggctcaacaag
cagttccgcaccgagatggaggacctcatgagctccaaggacgacgtaggcaagagcgtc
cacgagctggagaagtctaagcgggccctggagcagcaggtggaggagatgaagacccag
cttgaggagctggaggatgagcttcaggccactgaagatgccaagctgcggctggaggtg
aacctgcaggccatgaaggcccagttcgagcgggacctgcagggccgggacgagcagagc
gaggagaagaagaagcagctggtcagacaggtgcgggagatggaggcagagctggaagac
gagaggaagcagcgctcactggcagtggccgctcggaagaagctggagatggacctgaag
gacctagaggcccacatcgactctgccaacaagaaccgcgatgaagccatcaaacagctg
cggaagctgcaggcccagatgaaggactatatgcgggagctggatgacacgcgcgcctcc
cgcgaggagatcctggcacaggccaaggagaacgagaagaagctgaagagcatggaggcc
gagatgattcagctgcaggaggaactggcagctgccgagcgtgccaagcgtcaggcccag
caggagcgggacgagctggcagacgagattgccaacagcagcggcaaaggagccctggcg
ttggaggagaagcggcgcctggaggctcgcattgcccagctggaggaggagctggaagaa
gagcagggcaacacagagctggtgaacgaccggctcaagaaggccaacctgcagatcgac
cagatcaacactgacctgaacctcgagcgcagccacgcgcagaagaacgagaatgccagg
cagcagatggagcgccagaacaaggagctcaaggtcaagctgcaggagatggagggcact
gtcaagtccaagtacaaggcctccatcactgccctggaggccaagatcgcgcagctggag
gagcagctggacaatgagactaaggagcgccaggcggcctgcaagcaggtgcgtcgggca
gagaagaagctgaaggatgtgttgctgcaggtggatgacgagcgcaggaacgccgagcag
ttcaaggaccaggctgacaaggcgtccacccgcctgaagcagctcaagcggcagctggag
gaggccgaggaggaggcccagcgggccaatgcctcccgtcggaaactgcagcgcgagctg
gaggatgccaccgagaccgccgatgccatgaaccgggaggtcagctcgctcaagaacaag
ctcaggcgtggggacctgccatttgttgtgccccgccgaatggctcgcaaaggcactggc
gagtgctctgatgacgaggtggatggcaaggccgacggggcagaggccaaagctgccgaa
taa

DBGET integrated database retrieval system