KEGG   Miniopterus natalensis: 107524443
Entry
107524443         CDS       T05883                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04360  Axon guidance
mna04392  Hippo signaling pathway - multiple species
mna04510  Focal adhesion
mna04625  C-type lectin receptor signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04810  Regulation of actin cytoskeleton
mna05132  Salmonella infection
mna05170  Human immunodeficiency virus 1 infection
mna05205  Proteoglycans in cancer
mna05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107524443 (PAK1)
   04012 ErbB signaling pathway
    107524443 (PAK1)
   04014 Ras signaling pathway
    107524443 (PAK1)
   04392 Hippo signaling pathway - multiple species
    107524443 (PAK1)
   04024 cAMP signaling pathway
    107524443 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107524443 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107524443 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107524443 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    107524443 (PAK1)
   04660 T cell receptor signaling pathway
    107524443 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    107524443 (PAK1)
   04062 Chemokine signaling pathway
    107524443 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    107524443 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107524443 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107524443 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107524443 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107524443 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107524443 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107524443 (PAK1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107524443 (PAK1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107524443 (PAK1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE20 family
   107524443 (PAK1)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107524443 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    107524443 (PAK1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107524443 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 107524443
NCBI-ProteinID: XP_016051843
LinkDB
Position
Unknown
AA seq 544 aa
MSNNGIDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKLAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTESNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSSIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcatagacattcaagataaacccccagcccctccaatgagaaacacc
agcactatgattggagctggtagcaaagatgccggaaccctaaaccacggctccaaacct
ctgcctccaaatccagaggagaagaaaaagaaggaccgattttaccgatccatcttacct
ggagataaaacaaataaaaagaaggagaaggaacggccagagatttctcttccttccgat
tttgagcacacgattcacgttggctttgatgctgtcacaggggagtttacagggatgcca
gaacagtgggcccgcttgcttcagacatcaaatatcactaagtccgagcagaagaaaaac
ccacaggctgttctggatgtattggagttctataactcaaagaagacctccaacagccag
aagtacatgagcttcacagataaattagctgaggattataattcttctaacacattgaat
gtgaagactgtgtctgagacccctgcagtaccaccagtttcagaagatgaagatgatgat
gatgatgctaccccacctccagtgattgctccacgcccagagcacacaaaatctgtatac
acgcggtctgtgatcgaaccgcttcctgtcactccaactcgggacgtggctacatctccc
atttcgcctaccgagagcaataccactcctccagatgctctgacccggaatactgagaag
cagaagaagaagcctaaaatgtctgatgaagagatcttggagaaattacggagcatagtg
agtgttggtgatcctaagaagaaatatacacggtttgagaagattggacaaggtgcttca
ggcactgtgtacactgcaatggatgtagccacaggacaggaggtggccattaagcagatg
aaccttcagcagcagccgaagaaagagctgattattaatgagatcctggtcatgagggaa
aataagaacccaaatattgtgaactacttggacagttacctcgtgggagatgagctgtgg
gttgtcatggaatacttggctggaggctctttgacagatgtggtgacagaaacctgcatg
gatgaaggtcagatcgcagctgtttgccgtgagtgcctgcaggctttggagtttctacat
tccaaccaggtcattcacagagatatcaagagtgacaacatcctgttgggaatggatggc
tctgtcaagctaactgattttggattctgtgcccagatcactccagagcagagcaaacgg
agtaccatggtgggaaccccatactggatggcaccagaggttgtgacgcggaaagcctat
gggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggggag
cccccatacctcaatgaaaaccctttgagagccttgtacctcattgccaccaatgggacc
ccagagcttcagaacccagagaagctgtcatctatcttccgagactttctgaaccgctgc
cttgagatggatgtggagaagagaggttcagctaaagagctgttacagcaccagttcctg
aagattgccaagcccctctccagcctcactccactgatcgctgcagcaaaggaggcaacc
aagaacaatcactaa

DBGET integrated database retrieval system