KEGG   Miniopterus natalensis: 107524451
Entry
107524451         CDS       T05883                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107524451 (WNT11)
   04390 Hippo signaling pathway
    107524451 (WNT11)
   04150 mTOR signaling pathway
    107524451 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107524451 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107524451 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524451 (WNT11)
   05205 Proteoglycans in cancer
    107524451 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107524451 (WNT11)
   05226 Gastric cancer
    107524451 (WNT11)
   05217 Basal cell carcinoma
    107524451 (WNT11)
   05224 Breast cancer
    107524451 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107524451 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    107524451 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107524451 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107524451 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107524451 (WNT11)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107524451 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107524451
NCBI-ProteinID: XP_016051858
LinkDB
Position
Unknown
AA seq 354 aa
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFSDMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVATDLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSQGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtttgcgaggcgctgctcttcgccctggcgctccagaccggc
gtgtgctatggcatcaagtggctggccctgtccaagacgccggcagccctggctctgaac
cagacgcagcactgcaagcagctggagggcctggtgtctgcgcaggtgcagctgtgccgc
agcaacctggagctcatgcacaccgtggtgcacgccgcccgcgaggtcatgaaggcctgc
cgcagggccttctcggacatgcgctggaactgctcttccattgagctggcccccaactac
ctgcttgacctggagagagggacccgggagtccgccttcgtgtacgcgctgtcagcagcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcctggctgctcctgc
ggccctgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggagatgaagtgtaagtgccacggggtatctggctcttgctccatc
cgcacctgctggaaggggctgcaggagcttcgggatgtggccactgacttgaagacccgc
tacctgtcggccaccaaggtagtgcacagacccatgggcacccgcaagcacttggtgccc
aaggacttggacattcggcctgtgaaggactcggagcttgtctatctgcagagctcacct
gacttctgcatgaagaacgagaaggtgggctcccacgggacacaagacaggcaatgcaac
aagacatcccagggcagtgacagctgcgacctcatgtgctgtggacgcggctacaacccc
tacacagaccgcgtggtcgagcggtgccattgcaagtaccactggtgctgctatgtcacc
tgccgcaggtgtgagcgtacggtggagcgctacgtctgcaagtga

KEGG   Miniopterus natalensis: 107524769
Entry
107524769         CDS       T05883                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107524769 (WNT6)
   04390 Hippo signaling pathway
    107524769 (WNT6)
   04150 mTOR signaling pathway
    107524769 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107524769 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107524769 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524769 (WNT6)
   05205 Proteoglycans in cancer
    107524769 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107524769 (WNT6)
   05226 Gastric cancer
    107524769 (WNT6)
   05217 Basal cell carcinoma
    107524769 (WNT6)
   05224 Breast cancer
    107524769 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107524769 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    107524769 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107524769 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107524769 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107524769 (WNT6)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107524769 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107524769
NCBI-ProteinID: XP_016052306
LinkDB
Position
Unknown
AA seq 365 aa
MLPPAPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQEEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRRRAPPRPPALPGTLGPPGFVGSPEGSAVWEWGGCGDDVDFGD
EKSRLFMDARHKRGSGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGAELLERFHGASRVMGTNDGKALLPAVRSLKPPSRADLLYVADSPDFCAPNRRT
GSPGTRGRACNSSALDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHQCLVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccgcgccctcccgcctcgggctgctgctgctgctgctcctgtgtcccgcg
cacgtcggcggactgtggtgggcagtgggcagccccttggtcatggaccctacgagcatc
tgcaggaaggcccggaggctggcagggcggcaggctgagctgtgccaggaggagccggaa
gtggtggctgagttagcacggggtgcccggcttggggtccgagagtgccagttccagttc
cgcttccgccgctggaactgctccagccacagcaaggcctttgggcgcatcctgcagcag
gacatccgggagacggccttcgtctttgccatcacggctgcgggcgccagccacgcagtc
acgcaggcctgctccatgggcgagctgctgcagtgtggctgccaggcgccccgcaggcgg
gcccccccgcgaccccccgccctgccaggcaccctggggccccctggctttgtgggctcc
ccggagggcagcgcagtctgggagtgggggggctgcggggacgatgtggacttcggggat
gagaagtcccggctgttcatggacgcgcggcacaagcgggggagcggagacatccgagcg
ctggtgcaacttcacaacaacgaggccggccggctggccgtgcggagccacacgcgcacg
gagtgcaagtgccacggactgtcgggctcctgcgctctgcgcacctgctggcagaagctg
cccccgttccgcgaggtgggcgcggagctgctcgagcgcttccacggcgcctcgcgtgtc
atgggcaccaacgatggcaaggctctgctgcccgccgtccgcagtctcaagccgcccagc
cgcgctgacctactctacgtcgccgactcgcccgacttctgcgcccccaaccggcgcaca
ggctctcccgggacgcgcggccgcgcctgcaacagcagtgccctggacctcagcggctgc
gacctgctgtgctgtggccgcgggcaccgccaggagagcgtgcagctcgaagagaactgc
ctgtgccgtttccactggtgctgcgtagtgcagtgccaccagtgcctcgtgcgcaaggag
ctcagcctctgcctctga

KEGG   Miniopterus natalensis: 107524821
Entry
107524821         CDS       T05883                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107524821 (WNT10A)
   04390 Hippo signaling pathway
    107524821 (WNT10A)
   04150 mTOR signaling pathway
    107524821 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107524821 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107524821 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524821 (WNT10A)
   05205 Proteoglycans in cancer
    107524821 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107524821 (WNT10A)
   05226 Gastric cancer
    107524821 (WNT10A)
   05217 Basal cell carcinoma
    107524821 (WNT10A)
   05224 Breast cancer
    107524821 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107524821 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    107524821 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107524821 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107524821 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107524821 (WNT10A)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107524821 (WNT10A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107524821
NCBI-ProteinID: XP_016052361
LinkDB
Position
Unknown
AA seq 407 aa
MTSRGRRLSAQRWGVPGTPALLAAALPRSAPNDILGLRLPPEPVLNANTVCLTLPGLSKR
QMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESPIFSRGFRES
AFAYAIAAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSH
GVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHARMRLHNNRVG
RQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRNRFHRATLIRPHNRNSGQL
EPGPAGAPSPAPGVPGPRRRANPADLVYFEKSPDFCEREPRLDSAGTVGRLCNKSSAGPD
GCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacgtcacgtgggcgcaggctctcggcgcagcgctggggggtccccggcaccccagcn
ctgctggccgccgccctgcccaggtctgcacccaacgacattctgggcctccgccttccc
ccggagcctgtgctcaacgccaacaccgtgtgcctgacattgccgggcctgagcaagcgg
cagatggaggtgtgtgtgcgccaccctgatgtggctgcctcagccatccagggcatccag
attgccatccacgaatgtcagcaccagttccgggaccagcgctggaactgctctagtctt
gagactcgaaataagatcccctacgagagtcccatcttcagcagaggtttccgagagagt
gccttcgcctacgccatcgccgcagccggcgtagtgcacgcggtttccaatgcgtgcgcc
ctgggcaagctgcgggcatgcggctgtgacgcgtcccggcgcggggatgaagaggccttc
cgtcggaagctgcatcgcctgcagctggacgcgctgcagcgcggtaagggccttagccac
ggggttcccgagcacccagccctgccccctgccagccctggcctgcaggactcctgggag
tggggcggctgtagccccgacgtgggctttggagagcgcttctctaaggactttctggac
tcccgggagcctcacagagacatccacgcgcgcatgaggctccacaacaaccgagtagga
aggcaggccgtgatggagaacatgcggcggaagtgcaagtgccacggcacgtcaggcagc
tgccagctgaagacgtgctggcaggtgacgccggagttccgcgcggtgggggcgctgctg
cgcaaccgcttccaccgcgccacgctcatcaggccgcacaaccgcaacagcggccagctg
gagcccggcccggcgggggcgccctctccggccccgggcgttccggggccacgccgccgg
gccaaccctgcagacctggtctatttcgaaaagtcgcccgacttctgcgagcgcgagccg
cgcctggactcggctggcaccgtgggccgcctgtgcaacaagagcagcgcaggccccgac
ggctgcggcagcatgtgctgtggtcgcggccacaacatcctgcgccagacgcgcagcgag
cgctgccactgccgcttccactggtgctgcttcgtggtctgcgaggagtgccgcatcact
gagtgggtcagcgtctgcaagtag

KEGG   Miniopterus natalensis: 107524863
Entry
107524863         CDS       T05883                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107524863 (WNT2)
   04390 Hippo signaling pathway
    107524863 (WNT2)
   04150 mTOR signaling pathway
    107524863 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107524863 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107524863 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524863 (WNT2)
   05205 Proteoglycans in cancer
    107524863 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107524863 (WNT2)
   05226 Gastric cancer
    107524863 (WNT2)
   05217 Basal cell carcinoma
    107524863 (WNT2)
   05224 Breast cancer
    107524863 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107524863 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    107524863 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107524863 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107524863 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107524863 (WNT2)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107524863 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107524863
NCBI-ProteinID: XP_016052409
LinkDB
Position
Unknown
AA seq 360 aa
MNAPIGGIWLWLPLLLTWLRPEVSSSWWYMKATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTTECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGSAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWVAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctatcggtggaatctggctctggctccctctgctcttgacctggctcagg
cctgaggtcagctcttcatggtggtacatgaaagctacaggcggctcctccagggtgatg
tgtgacaatgtgccaggcctagtgagccgccagcggcagctgtgccaccgacacccagat
gtaatgcgcgccattggcctgggcgtggcagagtggacaactgagtgccagcaccaattc
cgccagcaccgctggaactgcaacaccttagacagggaccacagcctctttggcagggtc
ctgctccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgtgatccaaag
aagaagggaagcgccaaggacagcaagggcaccttcgactggggtggctgcagtgataac
attgactatgggatcaaatttgctcgagcatttgtggatgccaaggaaaggaaaggcaag
gatgccagagccttgatgaatctgcacaacaacagagccggcaggaaggctgtgaagcgg
ttcttgaaacaagaatgcaagtgtcatggcgtgagtggctcgtgtacattgaggacatgc
tggctggccatggctgacttcagaaaaactggcgattatctgtggaggaagtacaacggg
gctatccaggtcgtcatgaaccaggatggcactggtttcactgtggctaacaagaggttt
aagaagccaacgaaaaatgaccttgtgtattttgagaattctccagactactgtatcagg
gaccgagatgcaggctccctaggtacagcaggccgtgtgtgcaacctgacctcccgaggc
atggacagctgcgaagtcatgtgctgtggaagaggctatgacacctcccacgtcacgcgg
atgaccaagtgtgagtgtaagttccattggtgctgtgccgtgcgctgtcaggactgcctg
gaggccctggatgtgcacacatgcaaggcccctaagagtgcggactgggtggctcccaca
tga

KEGG   Miniopterus natalensis: 107528238
Entry
107528238         CDS       T05883                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107528238 (WNT10B)
   04390 Hippo signaling pathway
    107528238 (WNT10B)
   04150 mTOR signaling pathway
    107528238 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107528238 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107528238 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528238 (WNT10B)
   05205 Proteoglycans in cancer
    107528238 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107528238 (WNT10B)
   05226 Gastric cancer
    107528238 (WNT10B)
   05217 Basal cell carcinoma
    107528238 (WNT10B)
   05224 Breast cancer
    107528238 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528238 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    107528238 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107528238 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107528238 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107528238 (WNT10B)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107528238 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107528238
NCBI-ProteinID: XP_016056713
LinkDB
Position
Unknown
AA seq 389 aa
MQEEPRPRPPPWGLAGLLFLALCSRALTNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSGPSPSPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPAVGSPGTRGRACNKTSRQLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcaggaggagccccggccgcggcctccgccctggggcctcgcgggtcttctgttcctg
gcgctctgcagtcgggccctaaccaatgagattctgggcctgaagctgcccggcgagcca
ccgctcacagccaacaccgtgtgcttgacgctgtcgggcctgagcaagcggcagctaggt
ctgtgcctgcgcagccccgacgtgaccgcgtccgcgctccagggcctgcacatcgcggtc
cacgagtgtcagcaccagctgcgagaccagcgctggaactgctcggcgctcgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgtgagagtgccttttcc
ttctccatgctggctgctggggtcatgcacgcagtagctacagcctgcagcctgggcaag
ctggtgagctgcggctgcggctggaagggcagtggtgagcaggaccggctgagggccaaa
ctgctgcagctgcaggcactgtcccggggcaagagtttcccccactccctgcccagcccc
ggccctggctcaggccccagccctagcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtggggcgacaggtggtaact
gaaaacctaaaacggaaatgcaagtgccatggcacctcaggcagctgccagttcaagacc
tgctggagggcagccccagagttccgggcggtgggggcagccttaagggagcgactgggc
agggccatcttcatcgatacccacaaccggaactccggagccttccagccccgtctgcgt
ccccgtcgcctctcaggagagctggtttactttgagaagtctcctgatttctgtgagcga
gaccccgccgtgggctccccaggcacacggggccgggcctgcaacaagaccagccgccag
ctggatggctgtggtagcctgtgttgtggccgtgggcacaacgtgctccggcagacaaga
gttgagcgctgtcattgccgcttccattggtgctgctatgtgctgtgtgatgagtgcaag
gtcaccgagtgggtcaacgtgtgtaagtga

KEGG   Miniopterus natalensis: 107528239
Entry
107528239         CDS       T05883                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107528239 (WNT1)
   04390 Hippo signaling pathway
    107528239 (WNT1)
   04150 mTOR signaling pathway
    107528239 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107528239 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107528239 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528239 (WNT1)
   05205 Proteoglycans in cancer
    107528239 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107528239 (WNT1)
   05226 Gastric cancer
    107528239 (WNT1)
   05217 Basal cell carcinoma
    107528239 (WNT1)
   05224 Breast cancer
    107528239 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528239 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    107528239 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107528239 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107528239 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107528239 (WNT1)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107528239 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107528239
NCBI-ProteinID: XP_016056714
LinkDB
Position
Unknown
AA seq 370 aa
MGHWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTTGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcccggctgggtttctgctacgctgttgctggcgctggcc
gctctgcctgcagctctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctccacgaacctactgacagactccaagagtctgcaactggtgctggagcccagt
ctgcagctgctgagccgcaaacagcggcggctgatccgccagaacccagggatcctgcac
agtgtgagcggggggctgcagagcgctgtgcgcgagtgcaagtggcagttccggaaccgc
cgctggaactgccccacggcttcggggccccacctcttcggcaagatcgtgaaccgaggc
tgtcgggaaacagcatttatcttcgccatcacctccgccggggttacccactcggtggcg
cgctcctgctccgagggctccatcgagtcctgcacgtgcgactatcggcggcgaggccct
gggggccccgattggcactgggggggctgcagcgacaacatcgacttcggccgtctcttc
ggccgggagtttgtggattccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcgggccgaacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtcgggctcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgacgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctctacggcaac
cgcggcagcaaccgcgcctcgcgggccgagctgctccgcctcgagccggaagaccccgcg
cacaagccgccctcgccccacgacctggtctacttcgagaagtcacctaacttctgcacc
tacagcggacgcctgggtacagcgggcacgaccgggcgcgcctgcaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggccggggccaccgcacacgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtcctgcacgagtgtctgtga

KEGG   Miniopterus natalensis: 107529865
Entry
107529865         CDS       T05883                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107529865 (WNT9A)
   04390 Hippo signaling pathway
    107529865 (WNT9A)
   04150 mTOR signaling pathway
    107529865 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107529865 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107529865 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529865 (WNT9A)
   05205 Proteoglycans in cancer
    107529865 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107529865 (WNT9A)
   05226 Gastric cancer
    107529865 (WNT9A)
   05217 Basal cell carcinoma
    107529865 (WNT9A)
   05224 Breast cancer
    107529865 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107529865 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    107529865 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107529865 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107529865 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107529865 (WNT9A)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107529865 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 107529865
NCBI-ProteinID: XP_016058926
LinkDB
Position
Unknown
AA seq 358 aa
MGPEWGPRLGPCDEWCYVQALRWGLRLTGSEPLTILPLTLEPEAAVQAHYKACDRLKLER
KQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLY
AISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRR
SSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKRLKYK
YETALKVGSTTNEAAGEAGAISPPRGRASGTGGDPLPHTPELVHLDDSPSFCLAGRFSPG
TAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggggccagaatggggccctaggctggggccttgtgacgagtggtgctatgtgcaggcc
ttgcgctggggcctgaggctgaccggcagcgagcccctgaccatcctcccgctgaccctg
gagccagaggcagctgtgcaggcgcactacaaggcctgcgaccggctgaagctggagcgg
aagcagcggcgcatgtgccgccgggaccctggtgtggcggagaccctggtggaggcggtc
agcatgagcgcccttgagtgccagtaccagttccgctttgagcgctggaactgcaccctg
gagggccgctaccgtgccagcctgctcaagcgaggcttcaaggagactgccttcctctat
gccatctcctcggctggcctgacccacgcgctggccaaggcctgcagtgcaggccgcatg
gaacgctgtacctgcgatgaggcccctgacctggagaaccgagaggcctggcagtggggt
ggctgcggagacaacctcaagtacagcagcaagttcgtcaaggagttcctgggccggcgg
tcaagcaaggacctgcgtgcccgtgtggatttccacaacaacctcgtgggtgtgaaggtg
atcaaggctggggtggagaccacgtgcaagtgccatggtgtgtcaggctcctgtaccgtg
cggacgtgctggcggcagctggcacccttccatgaggtgggcaagcgcctgaagtacaag
tatgagacagcactcaaggtgggcagcaccaccaacgaggctgccggagaggcgggtgcc
atttcaccgccaaggggccgggcctcgggcacaggtggtgacccactgccccacacaccg
gagcttgtgcacctggatgactcgcccagtttctgcctggccggccgcttctccccaggc
actgctggccgcaggtgccaccgcgagaagaactgtgagagcatctgctgcgggcgaggc
cacaacacacagagccgggtggtgacacggccctgccagtgccaggtgcgctggtgctgc
tacgtggagtgcaggcagtgcacgcagcgggaggaggtctacacctgcaagggttag

KEGG   Miniopterus natalensis: 107529919
Entry
107529919         CDS       T05883                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107529919 (WNT3A)
   04390 Hippo signaling pathway
    107529919 (WNT3A)
   04150 mTOR signaling pathway
    107529919 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107529919 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107529919 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529919 (WNT3A)
   05206 MicroRNAs in cancer
    107529919 (WNT3A)
   05205 Proteoglycans in cancer
    107529919 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107529919 (WNT3A)
   05226 Gastric cancer
    107529919 (WNT3A)
   05217 Basal cell carcinoma
    107529919 (WNT3A)
   05224 Breast cancer
    107529919 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107529919 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    107529919 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107529919 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107529919 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107529919 (WNT3A)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107529919 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107529919
NCBI-ProteinID: XP_016058999
LinkDB
Position
Unknown
AA seq 290 aa
MPSVAEGIRISIEECQHQFRGRRWNCTTIDNSLAIFGPVLDKATRESAFVHAIASAGVAF
AVTRSCAEGSAAICGCSSRHQGSPGHGWKWGGCSEDIEFGGMVSREFADARENRPDARSA
MNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMV
VEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSP
GIDGCDLLCCGRGHNARAERRREKCLCVFHWCCYVSCQECARVYDVHTCK
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcccagcgtggcagagggcatcaggatcagcattgaggagtgccagcaccagttccgt
ggccgccggtggaactgcaccaccattgacaacagcctggccatctttggccctgtgctg
gacaaagccaccagagagtccgcctttgtgcacgccatagcctcagccggcgtggccttc
gctgtgacacgctcgtgcgccgagggctccgctgccatctgcggatgcagcagccgtcac
cagggctcaccgggccacggatggaaatggggtggctgcagcgaggacattgagtttggt
gggatggtgtctcgggagttcgcggacgcaagagagaataggcctgacgcccgctctgca
atgaaccgccacaacaatgaggctgggcgccaggccatcgcaagtcacatgcacctcaag
tgcaagtgccacgggctgtcgggcagctgcgaggtgaagacctgctggtggtcgcagccc
gacttccgcgccatcggcgacttccttaaggacaagtacgacagcgcctccgagatggtt
gtggagaagcaccgcgagtcgcgcggctgggtggagacgctgcggccgcgctacacctac
ttcaaagtgcccacggagcgcgatctggtctactacgaggcctcgcccaacttctgcgag
cccaaccccgagaccggctcctttggcacgcgcgaccgcacctgcaacgtgagctcgccc
ggcatcgacggctgcgacctgctgtgctgcggccggggccacaacgcacgggccgagcgg
cgccgggagaagtgcctgtgcgtctttcactggtgctgctacgtgagctgccaggagtgc
gcgcgcgtctacgatgtgcacacctgcaagtag

KEGG   Miniopterus natalensis: 107530103
Entry
107530103         CDS       T05883                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107530103 (WNT8A)
   04390 Hippo signaling pathway
    107530103 (WNT8A)
   04150 mTOR signaling pathway
    107530103 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107530103 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107530103 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530103 (WNT8A)
   05205 Proteoglycans in cancer
    107530103 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107530103 (WNT8A)
   05226 Gastric cancer
    107530103 (WNT8A)
   05217 Basal cell carcinoma
    107530103 (WNT8A)
   05224 Breast cancer
    107530103 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107530103 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    107530103 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107530103 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107530103 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107530103 (WNT8A)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107530103 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107530103
NCBI-ProteinID: XP_016059221
LinkDB
Position
Unknown
AA seq 352 aa
MGDLFMLRVAMGICYATFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRGATRETSFIHAISSAGVTHTITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKKTC
KCHGISGSCSIQTCWLQLADLREIGDYLKAKYDRALKIEMDKRQLRAGNSAEGRWAPNEA
FLPSAEAELMFLEDSPDYCIRNSSLGVHGTEGRECLQNSHNTSRWEQQSCRRLCTECGLR
VEERRTEAISSCNCKFQWCCVVKCDQCRHVVNKYYCSRSPGSTWSRGRGSTR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggggacctgttcatgctcagggtggctatgggcatatgctatgccaccttcagtgcc
tctgcctggtcagtgaacaatttcctgataacaggtcccaaggcctatctgacctacact
accagtgtggccctgggtgcccagagtggcattgaagagtgtaagttccaatttgcttgg
gaacgctggaactgccctgaaaatgctctccagctctctactcacaacaggctgagaggt
gccaccagggagacttcattcattcatgctatcagctctgcgggagtcactcacacaatc
accaagaactgtagcatgggtgactttgaaaactgcggctgtgatgagtcaaaaaatgga
aaaacaggaggccatggctggatctggggaggctgcagtgacaatgtggaattcggggaa
aggatctccaaactctttgtggacagcctggagaagggaaaggatgccagagccctgatg
aatcttcacaacaacagggcaggcaggctggcagtgagagccaccatgaaaaagacgtgc
aaatgccacggcatctcagggagctgtagcatccagacatgctggctgcagctggctgac
ctccgggagataggagactatctaaaggccaagtatgaccgggcactgaaaattgagatg
gataagcggcagctaagggctgggaacagtgccgagggccgctgggcacccaatgaagcc
ttccttcctagtgcggaggctgagctgatgtttttagaggactcaccagattactgtatc
cgcaattccagcctgggtgtccatggcacagagggtcgcgaatgtctgcagaacagccac
aacacatccaggtgggaacaacagagctgcaggcgcctgtgcaccgagtgtggcctgcgg
gtggaagagaggagaactgaggccatcagcagctgtaactgcaaattccagtggtgctgt
gtcgtcaagtgtgaccagtgtaggcatgtggtgaacaagtactattgctcacgctcccca
ggcagtacttggtcccgaggcaggggcagcacccgataa

KEGG   Miniopterus natalensis: 107530219
Entry
107530219         CDS       T05883                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107530219 (WNT3)
   04390 Hippo signaling pathway
    107530219 (WNT3)
   04150 mTOR signaling pathway
    107530219 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107530219 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107530219 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530219 (WNT3)
   05206 MicroRNAs in cancer
    107530219 (WNT3)
   05205 Proteoglycans in cancer
    107530219 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107530219 (WNT3)
   05226 Gastric cancer
    107530219 (WNT3)
   05217 Basal cell carcinoma
    107530219 (WNT3)
   05224 Breast cancer
    107530219 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107530219 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    107530219 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107530219 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107530219 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107530219 (WNT3)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107530219 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107530219
NCBI-ProteinID: XP_016059381
LinkDB
Position
Unknown
AA seq 303 aa
MPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAF
AVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSA
MNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMV
VEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSH
GIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECVRIYDVHTCKALGTVKCVAG
QIH
NT seq 912 nt   +upstreamnt  +downstreamnt
atgcccagcgtggccgagggcgtgaagctgggcatccaggagtgccagcaccagtttcgg
ggccgccgctggaactgcaccaccatagacgacagcctggccatctttgggcccgtcctt
gacaaagcgacccgcgagtcggccttcgtgcacgcgatcgcctcggccggcgtggccttc
gccgtgacgcgctcctgcgccgagggcacctccaccatctgcggctgcgactcccaccac
aaggggccgcccggcgagggctggaagtggggcggctgtagcgaggacgccgacttcggg
gtgctcgtgtcccgggagttcgccgacgcccgcgagaacaggcccgacgcgcgctcggcc
atgaacaagcacaacaacgaggcgggccgcacgaccatcctggaccacatgcacctcaag
tgcaagtgccacgggctgtcgggcagctgcgaggtgaagacctgctggtgggcccagccc
gacttccgcgccatcggtgacttcctcaaagacaagtacgacagcgcctcggagatggtg
gtggagaagcaccgcgagtcccgcggctgggtggagaccctgcgcgccaagtacgcgctc
ttcaagccgcccaccgagagggacctggtctactacgagaactcccccaacttttgcgag
cccaaccccgagacgggctcctttggcaccagggacaggacttgcaatgtcacctcccat
ggcatcgatggctgcgacttgctgtgctgcggccgaggccacaacacgaggaccgagaag
cggaaggagaaatgccactgcatcttccactggtgctgctacgtgagctgccaggagtgc
gtccgcatctacgacgtgcacacctgcaaggcgctgggaacggtgaagtgtgtggctggg
cagattcactga

KEGG   Miniopterus natalensis: 107530635
Entry
107530635         CDS       T05883                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107530635 (WNT5A)
   04390 Hippo signaling pathway
    107530635 (WNT5A)
   04150 mTOR signaling pathway
    107530635 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107530635 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107530635 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    107530635 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530635 (WNT5A)
   05205 Proteoglycans in cancer
    107530635 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107530635 (WNT5A)
   05226 Gastric cancer
    107530635 (WNT5A)
   05217 Basal cell carcinoma
    107530635 (WNT5A)
   05224 Breast cancer
    107530635 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107530635 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    107530635 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107530635 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107530635 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107530635 (WNT5A)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107530635 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107530635
NCBI-ProteinID: XP_016060002
LinkDB
Position
Unknown
AA seq 360 aa
MSSKFFLMALAIFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQK
KLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGRRETAFTYA
VSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDAR
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR
KVGDALKEKYDSAAAMRLNGRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGT
QGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcttccaagttcttcctaatggctttggccatatttttctccttcgcccaggttgta
atagaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggagcgcagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtaccaggaccacatgcagtacatcggagaaggcgcgaagacaggc
atcaaggaatgccagtatcagttccgacatcggcgatggaactgcagcactgtggataac
acctccgtgtttggcagggttatgcagataggtaggagagagacggccttcacgtacgcg
gtgagcgccgcgggggtggtcaacgccatgagccgcgcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgcccagggactggctgtggggc
ggctgcggcgacaacatcgactacggctatcgcttcgccaaggagttcgtggacgcgcgc
gagcgggagcgcatccacgccaagggctcctacgagagcgcgcgcatcctcatgaacctg
cacaacaacgaggcgggccgcaggacagtgtacaacctggccgacgtggcctgcaagtgc
cacggggtgtcgggctcgtgcagcctgaagacgtgctggctgcagctggccgacttccgc
aaggttggcgacgccctgaaggagaagtacgacagcgcggcggccatgcggctcaacggg
cgcggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacgcaggacctggtc
tacatcgaccccagccccgactactgcgtgcgcaacgagagcacgggctcgctgggcacg
cagggccgcctgtgcaacaagacgtccgagggcatggacggctgcgagctcatgtgctgc
ggccgcggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagttcgtgtgcaaa
tag

KEGG   Miniopterus natalensis: 107530990
Entry
107530990         CDS       T05883                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107530990 (WNT9B)
   04390 Hippo signaling pathway
    107530990 (WNT9B)
   04150 mTOR signaling pathway
    107530990 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107530990 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107530990 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530990 (WNT9B)
   05205 Proteoglycans in cancer
    107530990 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107530990 (WNT9B)
   05226 Gastric cancer
    107530990 (WNT9B)
   05217 Basal cell carcinoma
    107530990 (WNT9B)
   05224 Breast cancer
    107530990 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107530990 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    107530990 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107530990 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107530990 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107530990 (WNT9B)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107530990 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107530990
NCBI-ProteinID: XP_016060424
LinkDB
Position
Unknown
AA seq 319 aa
MGTAVAPAQGGAHLKQCDLLKLSRRQKQLCRREPGLAETLQDAAHLSLLECQFQFRHERW
NCSLEGRTGLLKRGFKETAFLYSVSAAALTHTLARACSAGRMERCTCDDSPGLESRQAWQ
WGVCGDNLKYSTKFLSNFLGPKRGSKDLRARVDAHNTNVGIKAVKSGLRTTCKCHGVSGS
CAVRTCWKQLSPFRETGQMLKLRYDSAVKVSSATNEALGRLELWAPAKLGSATKGLAPRP
GDLVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWC
CYVECQQCVQEELVYTCKH
NT seq 960 nt   +upstreamnt  +downstreamnt
atgggcaccgcagtggccccagcgcagggtggggcccacctgaagcagtgtgacctgctg
aagctgtcgcgccggcagaagcagctctgtcggcgggagcctggcctggctgagaccctg
caggatgccgcccacctcagcctgctcgagtgtcagttccagtttcggcatgagcgctgg
aactgcagtctggaggggaggacaggcctgctcaagagaggtttcaaggagacggccttc
ctgtactcggtgtccgcggccgccctcacccacaccctggcccgggcctgcagtgccggg
cgcatggagcgctgcacctgtgacgactctccaggcctggaaagcaggcaggcctggcag
tggggcgtgtgcggtgacaacctcaagtacagcaccaagtttctgagcaacttcctgggg
cccaagagaggaagcaaagacctgcgggcacgggtagatgcccacaacaccaatgtgggc
atcaaggctgtgaagagtggcctcaggaccacttgtaaatgccacggcgtgtcaggctcc
tgtgccgtgcgcacctgctggaagcagctctccccgttccgagagacgggccagatgctg
aagctgcgctatgactcagccgtcaaggtgtccagtgccaccaacgaggccttgggccgc
ctggagctgtgggcacctgccaagctgggcagtgccaccaagggcctggccccccggccc
ggggacctggtctacatggaggactcaccgagcttctgccggcccagcaagtactcccct
ggcactgcaggcagagtgtgctcccgggaagccagctgcagcagcctgtgctgcgggagg
ggctatgacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgc
tgctacgtggagtgccagcagtgtgtgcaggaagagctcgtgtacacctgtaagcactag

KEGG   Miniopterus natalensis: 107534839
Entry
107534839         CDS       T05883                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107534839 (WNT7B)
   04390 Hippo signaling pathway
    107534839 (WNT7B)
   04150 mTOR signaling pathway
    107534839 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107534839 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107534839 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534839 (WNT7B)
   05205 Proteoglycans in cancer
    107534839 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107534839 (WNT7B)
   05226 Gastric cancer
    107534839 (WNT7B)
   05217 Basal cell carcinoma
    107534839 (WNT7B)
   05224 Breast cancer
    107534839 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107534839 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    107534839 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107534839 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107534839 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107534839 (WNT7B)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107534839 (WNT7B)
SSDB
Motif
Pfam: wnt GP41
Other DBs
NCBI-GeneID: 107534839
NCBI-ProteinID: XP_016065566
LinkDB
Position
Unknown
AA seq 251 aa
MVMGPQSQATTANEGPHRALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGA
QMGLNECQYQFRFGRWNCSALGEKTVFGQELRVLEERMKLECKCHGVSGSCTTKTCWTTL
PKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYC
EEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNT
CSERTEVFTCK
NT seq 756 nt   +upstreamnt  +downstreamnt
atggtaatgggcccccagtctcaggccacaacggctaatgagggcccccaccgagcgctg
tcgtccgtcgtggccctaggagccaacatcatctgcaacaagatccctggtttggccccg
cggcagcgtgccatctgccagagccggcccgatgccatcatcgtgattggggagggggcg
cagatgggcctcaacgagtgccagtaccagttccgctttgggcgctggaactgctccgcc
ctcggggagaagaccgtgtttgggcaagagctccgagtgctggaggagcgcatgaaacta
gagtgcaagtgccacggcgtgtcgggctcctgcaccaccaagacgtgctggaccacgctg
cccaagttccgcgaggtgggccacctgctgaaggagaagtacaacgcggccgtgcaggtg
gaggtggtgcgggccagccgcctgcggcagcccaccttcctgcgcatcaagcagctgcgc
agctaccagaagcccatggagacggacctggtgtacatcgagaagtcgcccaactactgc
gaggaggacgcggccacgggcagcgtgggcacgcagggccgcctgtgcaaccgcacctcg
ccgggcgcggacggctgcgacaccatgtgctgcggccgcggctacaacacgcaccagtac
accaaggtctggcagtgcaactgcaagttccactggtgctgcttcgtcaagtgcaacacc
tgcagcgagcgcacggaggtcttcacctgcaagtga

KEGG   Miniopterus natalensis: 107537386
Entry
107537386         CDS       T05883                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16 isoform X1
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107537386 (WNT16)
   04390 Hippo signaling pathway
    107537386 (WNT16)
   04150 mTOR signaling pathway
    107537386 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107537386 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107537386 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537386 (WNT16)
   05202 Transcriptional misregulation in cancer
    107537386 (WNT16)
   05205 Proteoglycans in cancer
    107537386 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107537386 (WNT16)
   05226 Gastric cancer
    107537386 (WNT16)
   05217 Basal cell carcinoma
    107537386 (WNT16)
   05224 Breast cancer
    107537386 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107537386 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    107537386 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107537386 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107537386 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107537386 (WNT16)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107537386 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107537386
NCBI-ProteinID: XP_016068879
LinkDB
Position
Unknown
AA seq 362 aa
MWLGIASFGVPEKLGCANLPLSSRQKELCKRKPYLLPSIREGARLGIQECRSQFRHERWN
CQVAAAPPGTRPLFGYELSSGTKETAFIYAVTAAGLVHSVTRSCSAGNMSECSCDTALQA
GGSASEGWHWGGCSDDVQYGMWFSRKFLDFPVRNTTGKESKALLAMNLHNNEAGRQHVDR
HNSAASPDDLLICSAILWRLKEAVLTSLAVAKLMSVDCRCHGVSGSCAVKTCWRTMSSFE
KIGHLLKDKYENSVQVSDKIKKKMRRREKDQRKVPIHKDDLLYINKSPNYCVEDKRLGIP
GTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtggttgggcatcgcctccttcggggttccggagaagctgggctgcgccaacttgccg
ctgagcagccgccagaaggagctgtgcaagaggaagccgtacctgctgcccagcatccgg
gagggcgcccggctgggcattcaggagtgcaggagccagttcaggcacgagcggtggaac
tgccaggtcgccgccgccccgccgggcacccgccccctctttggctacgagctgagcagc
ggcacgaaggagacagcatttatttatgccgtgacggctgcaggcctggtgcattccgtg
accaggtcctgcagcgcgggcaacatgtccgagtgctcctgtgacaccgccttgcaggcc
ggcggctccgccagcgaaggctggcactggggcggctgctccgacgacgtccagtatggc
atgtggttcagcaggaagttcctggacttccccgtcagaaacaccacggggaaggaaagc
aaagcactgttagcaatgaaccttcataacaatgaagccggaaggcagcatgttgacaga
cataactctgcagctagccctgacgatttattaatctgctctgccatcctctggagactg
aaggaagctgtgctgactagcctggctgtcgccaagctgatgtcagtagactgccgctgt
cacggagtttctggctcctgtgctgtgaaaacatgctggagaaccatgtcttcctttgaa
aagattggccatctgttgaaggataaatatgagaacagtgttcaagtctcagacaaaata
aaaaagaagatgcgcaggagagaaaaagaccagaggaaggtgccgatccacaaggatgac
cttctctacattaacaagtctcccaactactgtgtagaggataagagattagggatcccg
gggacgcaaggcagagaatgcaaccggacgtcggagggtgcggatggctgcaacctcctc
tgctgcggccgaggctacaacacccacgtggtcaggcacgtggagaggtgtgagtgcaag
tttatctggtgctgctatgttcgctgcaggaggtgcgaaagcatgactgatgtccacact
tgcaagtga

KEGG   Miniopterus natalensis: 107537987
Entry
107537987         CDS       T05883                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107537987 (WNT7A)
   04390 Hippo signaling pathway
    107537987 (WNT7A)
   04150 mTOR signaling pathway
    107537987 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107537987 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107537987 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537987 (WNT7A)
   05205 Proteoglycans in cancer
    107537987 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107537987 (WNT7A)
   05226 Gastric cancer
    107537987 (WNT7A)
   05217 Basal cell carcinoma
    107537987 (WNT7A)
   05224 Breast cancer
    107537987 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107537987 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    107537987 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107537987 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107537987 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107537987 (WNT7A)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107537987 (WNT7A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107537987
NCBI-ProteinID: XP_016069600
LinkDB
Position
Unknown
AA seq 180 aa
MAAGTARRWASAPSSGRSSKWILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLK
GKYNEAVHVEPVRASRNKRPAFLKVKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGT
QGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSEHTEVYTCK
NT seq 543 nt   +upstreamnt  +downstreamnt
atggccgctggaactgctcggcgctgggcgagcgcaccgtcttcgggaaggagctcaaag
tggatcctggaggagaacatgaagctggagtgcaagtgccacggcgtgtcgggctcctgc
accaccaagacctgctggaccacgctgccccagttccgcgagctgggctacgtgctcaag
ggcaagtacaacgaggcggtgcacgtggagcccgtgcgggccagccgcaacaagcggccc
gccttcctgaaggtcaagaagccgctgtcctaccgcaagcccatggacaccgacctggtg
tacatcgagaagtcgcccaactactgcgaggaggaccccgtgacgggcagcgtgggcacg
cagggccgcgcctgcaacaagacggcgccccaggccagcggctgtgacctcatgtgctgt
ggccgtggctacaacacgcaccagtacgcccgcgtgtggcagtgcaactgcaagttccac
tggtgctgctacgtgaagtgcaacacctgcagcgagcacaccgaggtgtacacgtgcaaa
tga

KEGG   Miniopterus natalensis: 107538446
Entry
107538446         CDS       T05883                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04919  Thyroid hormone signaling pathway
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107538446 (WNT4)
   04390 Hippo signaling pathway
    107538446 (WNT4)
   04150 mTOR signaling pathway
    107538446 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107538446 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107538446 (WNT4)
   04916 Melanogenesis
    107538446 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    107538446 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538446 (WNT4)
   05205 Proteoglycans in cancer
    107538446 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107538446 (WNT4)
   05226 Gastric cancer
    107538446 (WNT4)
   05217 Basal cell carcinoma
    107538446 (WNT4)
   05224 Breast cancer
    107538446 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107538446 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    107538446 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107538446 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107538446 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107538446 (WNT4)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107538446 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107538446
NCBI-ProteinID: XP_016070185
LinkDB
Position
Unknown
AA seq 296 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAI
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRER
SKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALK
EKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRT
CNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtgcaagcggaacctggaggtgatggactcggtgcgccgtggcgcgcagctcgccatc
gaggagtgccagtaccagttccgcaaccggcgctggaactgctccacactcgactccctg
cctgtcttcggcaaggtggtgacgcaagggactcgggaggcggccttcgtgtacgccatc
tcttcagcaggtgtggccttcgcggtgacgcgggcgtgcagcagtggggagctggaaaag
tgcggctgtgaccggacagtgcacggggtcagcccccagggcttccagtggtcaggatgc
tcggacaacattgcctatggcgtggccttctcacagtcatttgtggatgtgcgggagaga
agcaagggggcctcatccagccgggccctcatgaacctccacaacaatgaggctggcagg
aaggccatcctgacacacatgcgggtggagtgtaagtgccatggggtatcaggctcctgc
gaggtcaagacgtgctggcgagccgtgccacccttccgccaagtgggccatgcactgaaa
gagaagttcgatggtgccaccgaggtggagccacgccgtgtgggctcctccagggcgctg
gtgccacgcaacgcacagttcaagccgcacacagatgaggacctggtgtacttggagccc
agcccagatttctgcgagcaggacatgcgcagcggtgtgctgggcaccaggggccgcacg
tgcaacaagacgtccaaggccatcgacggctgtgagctgctgtgctgtggccgcggcttc
cacacagcacaggtggagctggccgagcgctgcagctgcaaattccactggtgctgcttc
gtcaagtgccggcagtgccagcggctggtggagctgcacacgtgccggtga

KEGG   Miniopterus natalensis: 107542524
Entry
107542524         CDS       T05883                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107542524 (WNT8B)
   04390 Hippo signaling pathway
    107542524 (WNT8B)
   04150 mTOR signaling pathway
    107542524 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107542524 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107542524 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542524 (WNT8B)
   05205 Proteoglycans in cancer
    107542524 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107542524 (WNT8B)
   05226 Gastric cancer
    107542524 (WNT8B)
   05217 Basal cell carcinoma
    107542524 (WNT8B)
   05224 Breast cancer
    107542524 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107542524 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    107542524 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107542524 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107542524 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107542524 (WNT8B)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107542524 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107542524
NCBI-ProteinID: XP_016075329
LinkDB
Position
Unknown
AA seq 599 aa
MWPHGTGGSGALLASPPTLRGSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDR
WNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQL
GGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKC
HGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSIS
TRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRSLGRWERRSCRRLCGDCGLAVEERR
AETVSSCNCKFHWCCXQGGARLAANLLGNYYVTESWAQDRLETLQAQLETAVEAALPHLL
SDLSSTCSFPGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAV
KGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRG
AIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRSLGRWERRSCRRLCG
DCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPARKS
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgtggccacatggaacaggaggctcgggtgccctgctggcttcgccaccgactttaaga
gggtcagtgaacaattttctgatgactggtccaaaggcttacctgatctactccagcagc
gtggctgcgggcgcccagagcggcattgaagaatgtaaataccagtttgcctgggaccgc
tggaactgccccgagagagccctgcagctgtccagccacggtggccttcgcagtgctaat
cgggagacagcatttgttcatgccatcagttctgctggggtcatgtacactctcactagg
aactgcagccttggggattttgacaactgtggctgtgatgactcccgaaacgggcaactg
ggcggtcaagggtggctgtggggaggctgcagtgacaacgtgggctttggagaggcaata
tccaagcagttcgtcgatgccctggagacaggacaggatgctcgggcagccatgaacttg
cacaacaacgaggccggccgcaaggcggtgaagggcaccatgaaacgcacgtgtaagtgc
cacggcgtgtcaggcagctgcaccacgcagacctgctggctgcagctgcctgagttccgc
gaggtgggcgcgcacctgaaggagaagtaccacgccgctctcaaggtggacctgctgcaa
ggcgctggcaacagcgcggcgggacgcggcgccatcgccgacacctttcgctccatctcc
acgcgggagctggtgcacttggaggactccccagactactgcttggagaacaaaacgcta
gggctgctgggcaccgaaggccgagagtgcctgcggcgcgggcggtccctgggccgctgg
gagcggcgcagctgccgccggctctgcggggactgcgggctggcggtggaggagcgccgc
gccgagaccgtgtccagctgcaactgcaagttccactggtgctgcntgcaggggggcgca
cgcctcgccgcgaatcttctaggcaactactacgtcacggagtcctgggcacaggatcgg
ctagaaaccctccaagcccaattagagacggctgtcgaggcggctctgccccacctgctc
agcgacctttcctccacctgctcttttccaggcggtcaagggtggctgtggggaggctgc
agtgacaacgtgggctttggagaggcaatatccaagcagttcgtcgatgccctggagaca
ggacaggatgctcgggcagccatgaacttgcacaacaacgaggccggccgcaaggcggtg
aagggcaccatgaaacgcacgtgtaagtgccacggcgtgtcaggcagctgcaccacgcag
acctgctggctgcagctgcctgagttccgcgaggtgggcgcgcacctgaaggagaagtac
cacgccgctctcaaggtggacctgctgcaaggcgctggcaacagcgcggcgggacgcggc
gccatcgccgacacctttcgctccatctccacgcgggagctggtgcacttggaggactcc
ccagactactgcttggagaacaaaacgctagggctgctgggcaccgaaggccgagagtgc
ctgcggcgcgggcggtccctgggccgctgggagcggcgcagctgccgccggctctgcggg
gactgcgggctggcggtggaggagcgccgcgccgagaccgtgtccagctgcaactgcaag
ttccactggtgctgcgccgtccgctgcgagcagtgccgtcggcgagtcaccaagtacttc
tgcagccgcgcggagcggccgcgggggggcgccgcgcacaaacccgccagaaaatcctaa

KEGG   Miniopterus natalensis: 107545293
Entry
107545293         CDS       T05883                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107545293 (WNT2B)
   04390 Hippo signaling pathway
    107545293 (WNT2B)
   04150 mTOR signaling pathway
    107545293 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107545293 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107545293 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545293 (WNT2B)
   05205 Proteoglycans in cancer
    107545293 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107545293 (WNT2B)
   05226 Gastric cancer
    107545293 (WNT2B)
   05217 Basal cell carcinoma
    107545293 (WNT2B)
   05224 Breast cancer
    107545293 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107545293 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    107545293 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107545293 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107545293 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107545293 (WNT2B)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107545293 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107545293
NCBI-ProteinID: XP_016078828
LinkDB
Position
Unknown
AA seq 393 aa
MLKPGGAEDAAQPPPRRASAPVPVPAPRLAVPDGSRASARLSLACLLLLLLLALPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctgaagccgggtggtgcggaggacgccgcgcagccaccccctcggcgcgccagcgcc
cccgtccccgtgcccgctcccagactcgcggtccccgacggctctcgggcttcggcccgc
ctaagtcttgcctgcttgctgctgctgctgctgctggcgctgccggcccgcgtagacacg
tcctggtggtacatcggggcactgggggcccgagtgatctgtgacaatatccccggtttg
gtgagccggcagcggcagctgtgtcagcgatacccagacatcatgcgctcggtgggcgag
ggtgcccgagaatggatccgagagtgtcagcaccagttccgccaccaccgctggaactgc
accaccctggaccgggaccacactgtctttggccgtgtcatgctcagaagtagccgggag
gcagcatttgtgtatgccatctcgtcagcaggggtggtccacgctatcacccgcgcctgt
agccaaggtgaactgagtgtgtgcagttgtgacccctacacccgtggccgacaccatgac
caacgtggggactttgactggggtggctgcagtgacaacatccactatggcgttcgcttc
gccaaggccttcgtggatgccaaggagaagaggctcaaggatgcccgggccctcatgaac
ttgcataacaaccgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgtaag
tgccatggcgtgagtggctcctgtactctgcgcacctgctggcgtgcactctcagacttc
cgccgcaccggtgattacctgcggcgacgctatgatggggctgtgcaggtgacggccacc
caggatggcgccaacttcaccgcagcccgccaaggctatcgccgcgccacccggactgac
cttgtctactttgacaactccccagactactgtgtcttggacaaggctgcaggttcccta
ggcactgcaggccgtgtctgcagcaagacatctaaagggacagatggctgtgaaatcatg
tgctgtggccgagggtatgacacaactcgagtcactcgtgtcacccagtgtgagtgcaaa
ttccactggtgctgtgccgttcggtgcaaggagtgcagaaacactgtggacgtccacacc
tgcaaggcccccaagaaggcagagtggctggaccagacctga

KEGG   Miniopterus natalensis: 107546464
Entry
107546464         CDS       T05883                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107546464 (WNT5B)
   04390 Hippo signaling pathway
    107546464 (WNT5B)
   04150 mTOR signaling pathway
    107546464 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107546464 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107546464 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    107546464 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107546464 (WNT5B)
   05205 Proteoglycans in cancer
    107546464 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107546464 (WNT5B)
   05226 Gastric cancer
    107546464 (WNT5B)
   05217 Basal cell carcinoma
    107546464 (WNT5B)
   05224 Breast cancer
    107546464 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107546464 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    107546464 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107546464 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107546464 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107546464 (WNT5B)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Morphogens
   107546464 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107546464
NCBI-ProteinID: XP_016080368
LinkDB
Position
Unknown
AA seq 358 aa
MPGLLLLAAALLSSWAQLPAEASSWWSLAMNPVQRPEMFIIGAQPVCSQLPGLSPGQRKL
CQLYQEHMAYIGEGAKMGIKECQYQFRQRRWNCSTVDDTSVFGRVMQIGSRETAFTYAVS
AAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARER
EKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKV
GDQLKEKYDSAAAMRITRKGKLELVNSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQG
RLCNKTSEGMDGCELMCCGRGYDQFKSVQVERCHCKFHWCCFVKCRKCTEVIDQHVCK
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcccggcctgctgctgctcgccgctgcgctgctgtccagctgggctcagctcccagcc
gaagccagctcctggtggtcattagctatgaacccagtgcagagacctgaaatgttcatc
atcggtgcccagcctgtgtgcagccagcttcctgggctctcccctggacagagaaagctg
tgccagttgtaccaggagcacatggcctacataggggaaggagccaagatgggcatcaag
gagtgtcaataccagttccggcagagacggtggaactgcagcacagtggacgacacgtct
gtctttgggagggtcatgcagatagggagccgggagacggccttcacctatgccgtgagt
gccgcgggcgtggtgaacgccatcagccgggcctgccgagagggcgagctgtccacgtgt
ggctgcagcaggacagcgcggcccaaggaccttccccgggactggctgtggggcggctgt
ggggacaacgtggagtacggctaccggtttgctaaggagtttgtggatgcccgggagcgg
gagaagaactttgccaagggatcggaggagcagggccgggtgcttatgaacctgcagaac
aacgaggcgggtcgaagggctgtgtataagatggcagacgtagcctgcaaatgccacggc
gtctctgggtcctgcagcctcaagacctgctggctgcagctggctgagttccgcaaggtg
ggggaccagctgaaggagaaatacgacagcgcggcggccatgcgcatcacccgcaagggc
aagctggagctggtcaacagccgcttcaaccagcccacccccgaggacctggtgtacgtg
gaccccagccccgactactgcctgcgcaacgagaccacgggctccctgggcacccagggc
cgcctgtgcaacaagacctcggagggcatggacggctgcgagctcatgtgctgcggccgc
ggctacgaccagttcaagagcgtccaggtggagcgctgccactgcaagttccactggtgc
tgcttcgtcaagtgcaggaagtgcacggaggtcatcgaccagcacgtctgcaagtag

DBGET integrated database retrieval system