KEGG   Miniopterus natalensis: 107524457
Entry
107524457         CDS       T05883                                 

Gene name
ARRB1
Definition
(RefSeq) beta-arrestin-1
  KO
K04439  beta-arrestin
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04062  Chemokine signaling pathway
mna04144  Endocytosis
mna04340  Hedgehog signaling pathway
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107524457 (ARRB1)
   04340 Hedgehog signaling pathway
    107524457 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107524457 (ARRB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107524457 (ARRB1)
  09152 Endocrine system
   04929 GnRH secretion
    107524457 (ARRB1)
   04926 Relaxin signaling pathway
    107524457 (ARRB1)
   04928 Parathyroid hormone synthesis, secretion and action
    107524457 (ARRB1)
  09156 Nervous system
   04728 Dopaminergic synapse
    107524457 (ARRB1)
  09157 Sensory system
   04740 Olfactory transduction
    107524457 (ARRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107524457 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107524457 (ARRB1)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    107524457 (ARRB1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C LDB19
Other DBs
NCBI-GeneID: 107524457
NCBI-ProteinID: XP_016051865
LinkDB
Position
Unknown
AA seq 413 aa
MGVFKKASPNGKLTVYLGKRDFVDHIELVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGR
EDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPC
SVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAE
TTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFN
TAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTL
LREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREV
PENEAPVDTNLIELDTNDDDIVFEDFARQRLKGMKEDKEEEEDGTGSPRLNDR
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgggggtgttcaagaaggcgagcccaaatggaaagctcaccgtctatctgggaaagcgg
gactttgtggaccacatcgagctcgtggaccctgtggatggtgtggtcctggtggatcct
gagtacctcaaggagaggagagtctatgtgacactgacctgcgccttccgctatggccgg
gaggacctggatgtcctgggcctgacctttcgcaaggacctgtttgtggccaatgtgcag
tccttcccaccggcccccgaggacaagaagcccctgacccggctgcaggaacgcctcatc
aagaagctgggcgagcacgcctacccgttcacctttgagatccctccaaacctcccatgc
tcggtgacgttgcaaccagggcccgaagacacagggaaggcctgcggtgtggactatgaa
gtcaaagccttttgcgcagagaacctggaggagaagatccacaagcggaattccgtgcgc
ctggttatcagaaaggtgcaatacgccccggagaggcctggcccccagcccacagccgag
accaccaggcagttcctcatgtcggacaagcccttgcacctagaagcctccctggataaa
gagatctattaccacggagaacccataagcgtcaatgtccatgtcaccaacaacaccaac
aagacagtgaagaagatcaagatctcggtgcgccagtatgcggacatctgccttttcaac
acagcccagtacaagtgccctgtggccatggaagaggccgatgacacagtggcacccagc
tcaacgttctgcaaggtctacacgctcacccccttcctggccaacaatcgagagaagagg
ggccttgccctggatgggaagctcaagcatgaagacacaaacctggcctccagcaccctg
ttgagggaaggagccaacagagagatcctgggcatcattgtttcctacaaagtgaaagtg
aagctggtggtgtccaggggcggcctgttgggagatcttgcgtccagtgacgtggccgtg
gagctgcccttcaccctaatgcaccccaagcccaaagaggaacccccacatcgggaagtt
ccagagaacgaggcgccagtagataccaatctcatagaacttgacacaaacgatgacgac
attgtgtttgaggactttgctcgccagaggctgaaaggcatgaaggaggacaaggaggag
gaggaggatggcactggctctccgcggctcaacgacagatag

KEGG   Miniopterus natalensis: 107528069
Entry
107528069         CDS       T05883                                 

Gene name
ARRB2
Definition
(RefSeq) beta-arrestin-2
  KO
K04439  beta-arrestin
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04062  Chemokine signaling pathway
mna04144  Endocytosis
mna04340  Hedgehog signaling pathway
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528069 (ARRB2)
   04340 Hedgehog signaling pathway
    107528069 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107528069 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107528069 (ARRB2)
  09152 Endocrine system
   04929 GnRH secretion
    107528069 (ARRB2)
   04926 Relaxin signaling pathway
    107528069 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    107528069 (ARRB2)
  09156 Nervous system
   04728 Dopaminergic synapse
    107528069 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    107528069 (ARRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107528069 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107528069 (ARRB2)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    107528069 (ARRB2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C SCA7
Other DBs
NCBI-GeneID: 107528069
NCBI-ProteinID: XP_016056487
LinkDB
Position
Unknown
AA seq 409 aa
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPLTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTIKKIKVSVRQYA
DICLFSTAQYKCPVAQIEQDDQISPSSTFCKVYTVTPLLSNNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHISLPRPQS
AAPETDAPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDEDYDDQFC
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgggggagaaacccgggactagggtcttcaagaagtcgagccctaactgcaagctcact
gtgtacttgggcaagcgtgactttgtagatcacctggacaaagtggatcctgtagatggt
gtggtgcttgtggaccctgactacttgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgctatggccgtgaagacctggatgtgctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccctccaatgcccaacccaccccggcccctcactcgc
ctgcaggaccggctgctgaggaagctgggccaacatgcccaccccttttttttcacaata
ccccagaatctgccctgctctgtcactctgcagccaggcccagaggacacaggaaaggcc
tgtggcgtagactttgaaattcgagccttctgtgccaaatcactggaagagaaaagccac
aaaaggaactctgtgcggctggtgatccgaaaggtgcagtttgccccagagaaacccggc
ccccagccttcagctgaaaccacacgccacttcctcatgtctgaccggtccctgcacctt
gaagcttccctggacaaggagctgtactaccacggggagcccctcaatgtcaatgtccac
gtcaccaacaactccaccaagactatcaagaagatcaaagtctctgtgagacagtatgcc
gacatctgcctcttcagcactgcccagtacaagtgtcccgtggctcagatcgaacaagat
gaccagatatctcccagttccacgttctgcaaggtgtacaccgtaaccccactgctcagc
aacaaccgggagaagcgtggtcttgccctggatgggaagctcaagcatgaggacaccaat
ctggcttccagcaccatagtgaaagagggtgccaacaaggaggtgctggggatcctggtg
tcatacagggtcaaggtgaagctggtggtgtctcgcggtggggatgtgtcagtggagctg
ccttttgttcttatgcaccccaagccccatgaccacattagcctccccagaccccagtca
gctgctcctgaaacagatgcccctgtggacaccaacctcattgaatttgacaccaactat
gccacagatgacgacatcgtatttgaggactttgcccggcttcggctgaaggggatgaag
gacgaggactatgacgaccagttctgctag

DBGET integrated database retrieval system