KEGG   Miniopterus natalensis: 107524472
Entry
107524472         CDS       T05883                                 

Definition
(RefSeq) olfactory guanylyl cyclase GC-D-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04740  Olfactory transduction
mna04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107524472
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    107524472
   04740 Olfactory transduction
    107524472
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107524472
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107524472
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Peripla_BP_6 Kinase-like
Other DBs
NCBI-GeneID: 107524472
NCBI-ProteinID: XP_016051882
LinkDB
Position
Unknown
AA seq 1149 aa
MRPPQATACLKSLASRILVREPRIPKEAVSQPQQRSMAGLQGNLSPEDWYWKLSHRKTCL
GQWESTFSHPRITPSLPPFSVVLWGALLWAGSLPTLTWGAGTFTLGVLGPWDCDPIFAQA
LPSVAAQLAVDRANQDSSLVLGSRLASVVLPTGCHTPQALATFLAHKNTVAAFVGPVNPG
YCPAAALMAQGWGKTLFSWACGAPEGGGELVPTLPPAAHVLLSIMKHFGWARVAIVSSHQ
DIWVATARQVATTLRTHGLPVALVTSLGPGEQGATEVLKQLCSVDSLKIVVLCMHSALLG
GPEQMALLRQAWAQGLADGRLIFLPYDTMLFALPYRNRSYPALGHSGLLREAYDAVLSIT
LESGPMDKVFKAAGASGEVATLLEPEQVSPLFGTIYDAVVLLAHALNRSESHGTGFSGAS
LGDHTGALDVAGFSQRIRTDEKGRRLAQYVILDTDGWESQLVPTHILDTGTWQVQPLGRA
IHFPGGAPPARDSSCWFDPNTLCMRGTQPPGSLLVLALACVLLLAGGALTCLIRLGIQQL
QLVQGRHQILLTAQELTFIHTSLSRPRLHMDSASESRNVADGGSPRSVAPGSARSLSAPQ
EPTNVALYQGEWVWLKKFEAGTAPELRPSCLGLLRKVRELQHENVAACLGLFVAPGASAL
VLEHCARGSLEDLLQNEALRLDWTFKASLLLDLIRGVRYLHHLHFPHGRLKSRNCVVDER
FVLKITDHGYSALLDAQGAPGPWPAPEELLWMAPELLRGFGAPRQGTLSGDVFSVGIILQ
EVLTRGPPYGSSGLSAEEIIRKVASPPPLCRPLVSPDCGPPECIQLMEQCWEEAPEDRPN
LDQIYTQFKSINQGKKTSVADSMLQMLEKYSQNLEDLVQERTEELELERQKTERLLSQML
PPSVAEALKMGVTVKPEYFDQVTIYFSDIVGFTTISALSEPIEVVGLLNDLYTLFDAVLG
SHDVYKVETIGDAYMVASGLPRRNGSRHAAEIANMALDLLSSVGGFRMGHAPGVPVCIRA
GLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSRSTVQTLLSLDEGYKI
DVRGQTELKGKGVEETYWLVGKEGFPSPLPTPLDIKPEDPWKDFINQEIRAAFAKVRQGS
AGPSSSGKA
NT seq 3450 nt   +upstreamnt  +downstreamnt
atgaggcctccccaggccacagcttgtttgaagagcttggcatcgaggatcctggtgcga
gagcctaggatccccaaagaggcagtgagtcagccccagcagcgcagtatggcaggactg
caggggaacttgtcccctgaagattggtactggaagctatcacacaggaagacctgcctg
ggtcagtgggagtccactttcagccatccaagaataaccccttccctgccacctttctct
gtggttctttggggtgccctcctgtgggctggctccctccctactctgacctggggggcg
ggaaccttcaccctgggggtgctgggtccctgggattgtgaccccatctttgcccaggct
ctccccagtgtggctgcccagctggctgtggaccgagccaaccaggactcctcactggtg
ctgggctcccggctggcttccgttgtccttcccacggggtgtcacacccctcaagccctg
gccacgtttctggcccacaagaacaccgtagctgctttcgtgggtcctgtcaaccctggt
tactgcccagcagcagccctgatggcccaaggctggggcaagaccctcttctcctgggca
tgcggggctccagagggaggcggtgagctggtgcccactttgcctcctgctgcccacgtg
ctgctgtccatcatgaaacactttggctgggctcgagtggccattgtgtcctcccaccag
gacatctgggtggctacagcccggcaggtggccacgactctcaggacacatgggttgcct
gtggcgctggtgacttctctgggacctggggagcagggggccacagaggtactgaagcag
ctctgcagtgtggacagcctgaaaatcgtggtgctgtgcatgcactcggcactcctgggt
ggcccagagcagatggcccttctgagacaagcatgggcccagggcctggcagatgggagg
ctgatcttcctgccctacgacaccatgctcttcgccttgccctaccgaaaccgctcctac
ccagcccttggccacagtgggctcctccgagaggcctatgatgcagtgctcagcatcacc
ctggagtctggccccatggacaaggttttcaaagctgctggggccagcggagaggtggct
accctcctggagccagaacaggtgtccccactctttggcaccatctatgatgctgttgtc
ctgctggctcatgccctgaaccgctctgaaagccacgggacagggttctcgggggccagc
ttaggggaccacacaggggctctggatgtggctggctttagccagaggatcaggacggat
gaaaagggcaggaggctggctcagtacgtcattttggacacagatggctgggaaagccag
ctggtccccacccacattctggacacaggcacatggcaagtgcagcccctgggcagggcc
atacactttccaggaggggcccctccggcacgtgactccagctgctggtttgaccccaat
acactatgcatgagaggtacacagccccctggcagccttctcgttctggccctggcctgt
gtcctgttgctggccggcggggccctcacttgcctcatcagactgggcatccagcagctg
cagctggtgcaggggcgccaccagatcctgctgacagcccaggagctcaccttcatccat
acatccctgagcagaccgaggctgcatatggacagtgcgagtgaatcaagaaatgtggca
gatggtgggagcccgaggtcagtggccccggggtcagcaaggagcctgtcagccccacag
gagcctaccaacgtggccttgtaccagggcgagtgggtgtggctgaagaagtttgaagct
ggcacggctcctgagctgcggcccagctgcctcggcctcctaaggaaggtgcgagagctg
cagcatgagaacgttgctgcctgcctggggctcttcgtggcccctggggcgagtgctctg
gtgctggagcactgtgcccggggcagcctggaggacctgctgcagaacgaggctctgcgg
ctggactggaccttcaaggcctccctgctgctggatttgattcgcggagtgcggtatctg
caccatctacatttcccacatggtcgcctcaagtcccgaaactgtgtggtggacgagcgc
ttcgtgctgaagatcactgaccatggttactcggcgctcctggatgctcagggggccccc
ggcccctggccagccccggaggagctgctgtggatggctccggagctgctgcgggggttc
ggggcgcccaggcagggcaccctcagtggagatgtcttcagtgttggcatcatcctgcag
gaggttctgactcgaggcccaccctacggctcctcagggctctcagcagaagaaatcatc
agaaaggtggcatcaccgcctcccctgtgccggccactggtgtcccctgactgtgggcca
cccgagtgcatccagctgatggaacagtgctgggaggaggctccggaggacagacccaac
ctggaccagatctacacccagttcaaaagcatcaaccaaggcaagaagaccagtgttgct
gactccatgctgcagatgttggagaagtattcccagaacctggaggacctggtccaggag
cggactgaggaactggagctggagaggcagaagacagaaaggctgctctctcagatgctc
cctccgtctgtggcagaagctctgaaaatgggggtgactgtgaagccggagtactttgac
caagttaccatatacttcagtgacattgtgggtttcaccaccatctcagccctgagtgag
cccattgaggtggtaggcttgctcaacgacctctacacgctgtttgatgctgttctgggc
agtcatgatgtgtataaggtagagaccatcggggacgcctacatggtggcatcggggctg
ccgcggcgcaacgggagccggcacgcagctgagatcgccaacatggccctggacctcctc
agctccgtggggggcttccggatggggcacgcgcccggcgtgcccgtctgcatcagggct
ggcctgcactcagggccctgtgtggcgggggtcgtgggtctcaccatgcctcggtattgc
ctctttggggacactgttaacactgcatctcggatggagtccacagggctaccatacaga
attcatgtcagcagaagcactgtccagacactgctcagcctggacgaaggctacaaaatt
gacgtcagaggccagactgagctaaaggggaagggcgtggaagagacctattggctggtg
gggaaggaaggcttccccagccccctccccacacctctggacatcaagcctgaggatccc
tggaaggacttcattaaccaagaaattagggcagcttttgccaaagtccgccaaggctca
gctgggccttcgagctcaggaaaagcctag

KEGG   Miniopterus natalensis: 107544495
Entry
107544495         CDS       T05883                                 

Gene name
GUCY2D
Definition
(RefSeq) retinal guanylyl cyclase 1
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04740  Olfactory transduction
mna04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107544495 (GUCY2D)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    107544495 (GUCY2D)
   04740 Olfactory transduction
    107544495 (GUCY2D)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107544495 (GUCY2D)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107544495 (GUCY2D)
SSDB
Motif
Pfam: Guanylate_cyc PK_Tyr_Ser-Thr Pkinase ANF_receptor HNOBA Kinase-like
Other DBs
NCBI-GeneID: 107544495
NCBI-ProteinID: XP_016077884
LinkDB
Position
Unknown
AA seq 922 aa
VALVTAPQDLWVEAGRSLAAALRARGLPVALVTAMEPSDLSGAREALRRVRDGPGVRAVI
MVMHSVLLGGQEQRCLLEAAEELGLADGALVFLPFDTLHYALSPGPEALAVLANSSQLRR
AHDAVLTLTRRCPAGGSVLDSLRRARERRELPPDLNLQQVSPLFGTIYDAVFLLAGGVVR
ARAAVGGSWVSGAAVARHIHDAQVPGFCGALGGAEEPPFVLLDTDEAGDKLLATYMLDPT
RGSFHSAGTPVHFPRGGQGPGPDPSCWFDPDIICSGGVDPGLVFIGFLLVVGMGLTGAFL
AHYVRHQLLHIQMISGPNKIILTLDDITFLHPPGGSSQKVAQSSSRSSLVARSVSDIRSV
PSQPPDGSNIGLYEGDWVWLKKFPGDQHIAIRPATKTVFSKLRELRHENVALYLGLFLAG
GADGAGPGEGTLAVVSEHCARGSLHDLLAQRDIKLDWMFKSSLLLDLIKGMRYLHHRGVP
HGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPAPASAEDQLWTAPELLRDPALGRRG
TLAGDVFSLGVIMQEVVCRSAPYAMLELAPEEVVQRVQNPPPLCRPLVSVDQAPMECIQL
MKQCWAEQPDHRPSMDRTFNLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELE
LEKQKTDRLLTQMLPPSVAEALKMGTPVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVD
LLNDLYSLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMALDILSAVGSF
HMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNVS
TVRILRALDQGFQTEVRGRTELKGKGTEETHWLVGRRGFNKPIPKPPDLQPGASHHGINL
QEIPPERRRKLEKARPGQFSGK
NT seq 2769 nt   +upstreamnt  +downstreamnt
gtggccctggtcaccgccccccaggacctgtgggtggaggcgggacgctcgctggccgcg
gcgctcagggcccgggggctgccagttgccctggtgaccgccatggagccctccgatctg
tctggagcccgcgaggccctgaggagggtccgggacgggcccggagtccgagcggtgatc
atggtgatgcactcggtgctgctgggcggccaggagcaacgctgcctgctggaggctgca
gaggagctgggcctggccgacggcgccctggtcttcctgcccttcgacacgctccactac
gccttgtccccgggcccggaggccttggccgtgctggccaacagctcacagctccgcagg
gcccacgacgcggtcctcacgctcacgcgccgctgccccgctggaggcagcgtgctggac
agtctgcgacgggcccgggagcgccgggagctgcctcctgaccttaatctgcagcaggta
tccccactcttcggcaccatctatgatgcggtcttcttgttggcggggggcgtggtgcga
gcgcgggcagctgttggtggcagctgggtgtctggagcagctgtggcccgccacattcac
gatgcccaggtcccaggcttctgcggggccctgggaggagctgaggagcccccatttgtg
ctgttggacacggacgaggcgggagacaagctgctggctacatacatgctggaccccacc
cggggctccttccactctgctgggaccccagtgcatttccctagagggggccagggtcct
gggcctgacccctcctgctggtttgacccagacatcatctgcagtggaggagtggatcct
ggtctcgtctttatcggtttcctcctggtggttgggatggggctgaccggggccttcctg
gcccattatgtgaggcaccagctgcttcatatccaaatgatctcaggccccaacaagatc
atcttaactctggatgacatcaccttcctccacccaccagggggcagctctcaaaaggtg
gcccagagtagtagtcggtcgagtctggttgcccgcagtgtgtcagacattcgcagcgtc
cccagccagcccccggatggctccaatatcggcctctatgagggagactgggtttggctg
aagaaattcccaggggatcagcacatagctatccgcccagcaaccaagacagtcttctcc
aagctccgggagctccggcacgagaacgtggccctctacctggggctgttcctggcgggc
ggggcggacggcgcgggccccggggagggcacgctcgcggtggtctccgagcactgcgcc
cggggctccctccacgacctgctggcccagagagacatcaagctggactggatgttcaag
tcctccctcctgctggacctcatcaagggaatgcggtacctgcaccaccgaggggtgccc
cacgggcgactgaagtcccggaactgcgtggtggacgggagattcgtgctcaaggtcacc
gaccacggccacgggagactactggaggctcagagggtgttaccagcgcctgccagcgcg
gaggaccagctgtggacagccccggagctgctgcgcgacccagccctggggcgccgggga
acgctggccggcgacgtcttcagcctgggggtcatcatgcaggaggtcgtgtgccgcagc
gccccctacgccatgctggagctggcgcccgaggaagtggtgcagagggtgcagaacccc
cctccgctgtgtcggcccttggtttccgtggaccaggcacccatggagtgcatccagctg
atgaaacagtgctgggcagaacagccggaccatcggccttccatggaccgcaccttcaac
ctgttcaagagcatcaacaagggccgaaagaccaacattatcgactccatgctacggatg
ctggagcagtactccagtaacctggaggacctgatccgggagcgcacggaggagctggag
ctggaaaagcagaagacagacagactactcacccagatgctccctccgtctgtggctgaa
gctctgaagatggggacacctgtggagcccgagtattttgaggaggtgacactgtacttt
agcgacattgtgggcttcaccaccatctccgccatgagtgagcccatcgaagtcgtggac
ctgctcaacgacctctattcgctcttcgatgccatcattggctcccatgatgtctacaag
gtggagacaattggggacgcctatatggtggcctccgggctgccccagcgcaatgggcag
cggcacgcagccgagatcgccaacatggccctggacatcctcagcgccgtgggctccttc
cacatgcgccacatgcccgaggtgcccgtgcgcatccgcattggcttgcactcgggcccg
tgcgtggcgggcgtggtgggcctcaccatgccgcggtactgcctctttggggacacggtc
aacaccgcctcgcgcatggagtccacggggctgccttaccgcatccacgtgaacgtgagc
accgtgcggatcctccgcgctctagaccagggcttccagaccgaggtgcgcggccgcacc
gagctgaagggcaagggcaccgaggaaacgcactggctggtgggcaggcgcggcttcaac
aagcccatccccaaacctccagacctgcaaccaggggccagccaccacggcatcaacctg
caggagatacccccggagcggcgtcggaagctggagaaggcgaggccgggccagttctcg
ggaaagtga

DBGET integrated database retrieval system