KEGG   Miniopterus natalensis: 107524507
Entry
107524507         CDS       T05883                                 

Gene name
ADORA2B
Definition
(RefSeq) adenosine receptor A2b
  KO
K04267  adenosine receptor A2b
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107524507 (ADORA2B)
   04020 Calcium signaling pathway
    107524507 (ADORA2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107524507 (ADORA2B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107524507 (ADORA2B)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    107524507 (ADORA2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107524507 (ADORA2B)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    107524507 (ADORA2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C
Other DBs
NCBI-GeneID: 107524507
NCBI-ProteinID: XP_016051930
LinkDB
Position
Unknown
AA seq 330 aa
MPLEAQDAVYVALELAIAALSVAGNVLVCAAVGASSALQTPTNYFLVSLAVADVAVGLFA
VPFAVTISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIHVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSAANCTESWDGTINESCCLVRCLFENVVPMSY
MVYFNFFGCVLPPLLIMLVIYIKIFMVACRQLQRMELMDHSRTVLQWEIHAAKSLAMIVG
IFAVCWLPLHAINCVTLFQPAQAKPKWAMNMAILLSHANSVVNPIVYAYRNQDFRYTFHK
IISRYVFCQTDVFKSGNGQVGAQPALDVGL
NT seq 993 nt   +upstreamnt  +downstreamnt
atgccgctggaggcgcaggacgcggtgtacgtggcgctcgagctggccatcgccgcgctg
tcggtggcgggcaacgtgctggtgtgcgcggcggtgggcgcgtcgagcgcgctgcagacg
cccaccaactacttcctggtgtccctggccgtggcggacgtggccgtggggctgttcgcc
gtcccctttgccgtcaccatcagcctgggcttctgcaccgacttccacagctgcctcttc
ctcgcctgcttcgtgctcgtgctcacgcagagctccatcttcagcctcttggccgtggcc
gtcgacaggtacctggccatccacgtcccgctcagatataagagtttggtcactgggacc
cgagcgagaggagtcattgctgttctctgggtgcttgcctttggcattggactgacccct
ttcctggggtggaacagtaaagacagtgcggccaactgcacagagtcctgggatggaacc
ataaatgaaagctgctgccttgtgaggtgtctttttgagaatgtggtccccatgagctac
atggtatatttcaatttctttgggtgtgtcctacccccactgctcataatgctagtgatc
tacatcaagatcttcatggtggcctgtaggcagcttcagcgcatggagctgatggaccac
tccaggaccgtcctccagtgggagatccacgccgccaagtccctggccatgattgtgggg
atttttgctgtgtgctggctaccactgcacgccatcaactgtgtcactctttttcagcca
gctcaggctaagcccaagtgggcaatgaacatggctattctcctgtcacatgccaactca
gttgtcaatcccattgtttatgcctacaggaaccaagactttcgctatacttttcacaaa
atcatctccaggtatgttttctgccagacagatgtcttcaagagtgggaatgggcaggtg
ggggcacagcctgctcttgatgtgggcctatga

KEGG   Miniopterus natalensis: 107530474
Entry
107530474         CDS       T05883                                 

Gene name
ADORA2A
Definition
(RefSeq) adenosine receptor A2a
  KO
K04266  adenosine receptor A2a
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
mna05012  Parkinson disease
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107530474 (ADORA2A)
   04020 Calcium signaling pathway
    107530474 (ADORA2A)
   04024 cAMP signaling pathway
    107530474 (ADORA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107530474 (ADORA2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107530474 (ADORA2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107530474 (ADORA2A)
  09165 Substance dependence
   05034 Alcoholism
    107530474 (ADORA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107530474 (ADORA2A)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    107530474 (ADORA2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C DUF4199
Other DBs
NCBI-GeneID: 107530474
NCBI-ProteinID: XP_016059729
LinkDB
Position
Unknown
AA seq 409 aa
MGSSVYIVVELAIAVLAVLGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFA
ITISIGFCAACHSCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGARAKG
IIAICWVLSFAIGLTPMLGWNNCSQPKEDRNHSQDCGEGQVACLFEDVVPMNYMVYYNFF
ACVLVPLLLMLGIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFA
LCWLPLHIINCFTFFCPQCSHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKII
RSHILRQREPFKAGGTSARALAAHGSDGEQISLRLNGHPPGVLANGSAPHPERRPNGYAL
GLVSGGGACEFHGDTGLPDVQLLSHELREPCPESPGLEGPLAQDVAGVS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgggctcctcggtgtacatcgtggtggagctggccattgccgtgctggctgtcctgggc
aatgtgctggtgtgctgggctgtgtggctgaacagcaacctgcagaacgtcaccaactac
tttgtggtgtcactggcggcagccgacatcgcagtgggggtccttgccatcccctttgct
atcaccatcagcatagggttctgtgctgcctgccacagctgcctcttctttgcgtgcttc
gtcctggtcctcacacagagctccatcttcagcctcctggccattgccattgaccgctac
atcgccatccgcatcccactccggtacaatggcttggtgaccggtgccagggccaagggc
atcattgccatctgctgggtgctgtcctttgccatcggcctgacacccatgctgggctgg
aacaactgcagtcagccaaaggaggacagaaaccactcgcaggactgcggggagggccag
gtggcctgtctctttgaagacgtggtccctatgaactacatggtgtactacaacttcttt
gcttgtgtcctggtgcccctgctgctcatgctgggcatctatctgcgcatcttcctggca
gcccggcggcagctgaagcagatggagagccagcctttgccaggggagcggactcggtcc
acgctgcagaaggaggtccatgcagcgaagtcgctggccatcattgtggggctcttcgcc
ctctgctggctgcccctgcacatcatcaactgcttcaccttcttctgcccccagtgcagc
catgccccgccctggctcatgtacctggccatcatcctctcccactccaattctgttgtg
aatcccttcatctatgcctaccgcatccgtgagttccgccagaccttccgaaagatcatt
cgcagccacatcctgaggcagcgagagcccttcaaggcaggtggcaccagtgcccgggcc
ttggcagctcatggcagcgatggagagcagatcagcctccgcctcaatggccaccctcct
ggggtgttggccaacgggagcgccccccatcctgagcggcggcccaatggctatgctctg
gggctggtgagtggagggggtgcctgcgagttccatggggacacgggcctcccagatgtg
cagctcctcagccacgagctcagggaaccatgcccagagtcccctggccttgagggcccc
ctggcccaggatgtagcaggagtgtcctga

DBGET integrated database retrieval system