KEGG   Miniopterus natalensis: 107524519
Entry
107524519         CDS       T05883                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04540  Gap junction
mna04657  IL-17 signaling pathway
mna04722  Neurotrophin signaling pathway
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna05206  MicroRNAs in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107524519 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107524519 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107524519 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107524519 (MAPK7)
   04921 Oxytocin signaling pathway
    107524519 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107524519 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107524519 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107524519 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107524519 (MAPK7)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107524519 (MAPK7)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107524519 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 107524519
NCBI-ProteinID: XP_016051943
LinkDB
Position
Unknown
AA seq 810 aa
MAEPLKEEDGEDGSGEPPGPVKAEPAGTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPSCPDIEMP
SSWAPSGDCAMESPPPAPLPCPGPASDTIDMTLQPPPPLASEPAPPKREGAISDNTKAAL
KAALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERE
RKERGTGASGGPSTDPLAGLVLSDNDRSLLERWTRMAQPPAPTLAPAHATVTTPPAQPTS
PPAGPVAQPTGPPLQPVGSTPGPTPQPACPPPGPAPHPAGPPGPGPSPLQTTTTSSLLAP
QSLVPPPGMPGSSTLGVLPYFPSGPPPPDPRGGPQPSTSESPDVNLVTQQLSKSQVEDPL
PPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGMADGPQDGQTDSASLSASLLADWLEGHG
MNPSDIESLQHEIQMDSPMLLADLPDLQEP
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggccgagcccctgaaggaggaagacggcgaggacggctctggggagccccccgggccg
gtgaaggcggaacccgccggtaccgccgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgacgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaacggcgcctacggggtggtgtcctctgcacgccgccggctcaccggccagcag
gtggccattaagaagatccctaatgcttttgatgtggtgactaatgccaagcggaccctc
agagagctgaagatcctcaaacacttcaagcatgacaacatcattgccatcaaggacatc
ctgaggcccacggtgccctatggcgagttcaaatctgtttatgtggtcttggacctgatg
gagagtgacctgcaccagatcatccactcctcgcagccgctcacactggagcacgtgcgc
tacttcctatatcagctgctgcggggcctcaagtacatgcactcagctcaggtcatccac
cgtgacctcaagccatctaacttgttggtgaatgagaactgtgagctcaagattggtgac
tttggcatggcgcggggcctgtgcacttcaccagctgagcatcagtactttatgaccgag
tatgtggccacgcgctggtaccgtgcccctgagctcatgctttcactgcatgagtacacg
caagctattgacctgtggtccgtgggctgcatctttggtgagatgctggccaggcgccag
ctcttcccaggcaaaaactatgtgcaccagctgcagctgatcatgatggtactgggtacc
ccatcgccagctgtgattcaggctgtaggggctgaaagggtacgggcatatatccagagt
ctgccaccacgccagcctgtgccctgggagacagtgtacccaggcgctgaccgccaggcc
ctctccctgctggggcgaatgctgcgttttgagcccagtgcccgtatctcagcagctgct
gcccttcgacaccccttcttggccaagtaccatgaccctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgaccgagaagccctcacccgggagcggattaaggaagcc
attgtggccgagattgaggacttccatgcacggcgtgagggcatccgccagcagattcgc
ttccagccttctctgcagcctgtggccagtgagcctagctgccctgacattgagatgccc
agttcctgggctcccagtggggactgtgccatggagtcacctccaccagccccactgcca
tgccctggcccagcatctgacaccattgatatgaccctgcagccacctcccccattggcc
agtgaaccagcccctccaaagagggaaggtgccatctcagacaacaccaaggcagccctc
aaagctgccctgctcaagtccttgcggagccggctcagagatggccccagtgccccccta
gaagcacctgagcctcggaagccagtgacagcccaggagcgccagcgcgaacgggaagag
aagcggcggcggcggcaggagcgagcaaaggagcgggaaaagcgccggcaggagcgggag
cgcaaggagcgagggactggggcctctggaggcccttctaccgatcccctggctgggctg
gtgctcagtgacaatgatcgcagcctgctggagcgctggactcgaatggcccagccccca
gcccccacccttgcaccagcccatgccacagtaacaactcctccagcccagcccaccagc
cctcccgctggccctgtagcccagcccactggacccccactgcaacctgtaggctctacc
cctggtcctacaccacaacctgcctgcccacctcctggccctgctccccaccctgctggc
ccccctgggcctggcccttctccactccagaccaccaccacctccagcctcctggccccc
cagtcacttgtgccacctcctgggatgcctggctccagtaccctgggtgttctgccttac
ttcccatctggcccaccccctccagaccccagggggggccctcaaccctccacctcagag
tcacctgatgtcaacctggtgacccagcagctgtccaagtctcaggtggaggaccctttg
ccccccgtgttctcaggcactccaaagggcagtggggctggttatggtgttggctttgac
ctggaagaattcctaaaccagtctttcgatatgggcatggctgatggcccacaggatggc
cagacagactcagcctcgctctcagcctccctgcttgccgactggctcgagggccatggc
atgaacccttccgacattgagtctctgcagcatgagatccagatggattcccccatgctg
ctggctgacctgcctgacctccaggagccctga

DBGET integrated database retrieval system