KEGG   Miniopterus natalensis: 107524611
Entry
107524611         CDS       T05883                                 

Gene name
POU1F1
Definition
(RefSeq) pituitary-specific positive transcription factor 1 isoform X1
  KO
K09363  POU domain transcription factor, class 1
Organism
mna  Miniopterus natalensis
Pathway
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107524611 (POU1F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107524611 (POU1F1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    107524611 (POU1F1)
SSDB
Motif
Pfam: Pou Homeodomain Homeobox_KN Lsr2 MFS_MOT1
Other DBs
NCBI-GeneID: 107524611
NCBI-ProteinID: XP_016052040
LinkDB
Position
Unknown
AA seq 316 aa
MSCQPFTSADTFIPLNSESSAALPLLMHHSAAECLPVSNHTTNVMSTVPSILSLIQTSKC
LCTYFSVTTLGNTATGLHYSVPSCHYGNQPSTYGVMAGSLAPCLYKFPDHALGPGFAPPQ
PLLAEDPAAAQFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGE
ALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKR
KRRTTISIAAKGALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTS
LNQSLFSISKENLECR
NT seq 951 nt   +upstreamnt  +downstreamnt
atgagttgccaaccttttacttcggctgacaccttcatacctcttaattcggagtcttct
gcagctctgcctctgctaatgcaccacagcgctgccgagtgcctaccggtctccaaccac
accaccaatgtgatgtccacagtcccgtctattttgtctttgatccaaacttctaaatgt
ttgtgcacatatttctcggtgacaacattgggaaacacagcaactggacttcattactct
gttccttcctgtcattacggaaatcagccatcaacctacggagtgatggcaggcagcctg
gcgccctgcctctacaagttccccgaccacgccctgggccccggcttcgcgcccccccag
cccctcctggccgaggaccccgcggccgcccagttcaagcaggagctccggcgaaaaagc
aaactggtggaagagccaatagacatggattctccggaaattcgagagctggagaagttc
gccaatgagtttaaagtgagaagaattaagttaggatacacccagacaaatgttggggaa
gccctggcagctgtgcacggctccgaattcagtcagacaactatctgccgatttgaaaac
ctgcagctcagcttcaaaaatgcatgcaaactaaaagcaatactatccaaatggctggag
gaagccgagcaagtgggagctttatacaatgaaaaagtgggagcaaacgaaaggaaaagg
aaacggagaacaaccataagcattgctgcaaaaggtgccctggagagacactttggagag
cagaataagccctcctcccaagagatcatgaggatggccgaagaactgaatcttgagaag
gaggtagtaagagtttggttttgcaacagaaggcagagagaaaaacgggtgaaaacaagt
ttgaatcagagtttatttagtatttccaaggaaaatcttgaatgcagataa

DBGET integrated database retrieval system