KEGG   Miniopterus natalensis: 107524635
Entry
107524635         CDS       T05883                                 

Gene name
TTF1
Definition
(RefSeq) transcription termination factor 1
  KO
K15225  transcription termination factor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107524635 (TTF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107524635 (TTF1)
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    Transcription termination factors
     107524635 (TTF1)
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 DUF1214 F5_F8_type_C
Other DBs
NCBI-GeneID: 107524635
NCBI-ProteinID: XP_016052080
LinkDB
Position
Unknown
AA seq 743 aa
MEGESSRWEIRTPVFDKKKKKYSVDKERHRTHAQEGFRDVPPASEQSHKTKKKRKDRQHL
ASSAWKAPELLEEPEKAASAARRRRSSAPGLQDEAGVCILVDKANIENTSKSRRRNVDIV
YVDMSKEQEAARAPGAAEPRAVSKRHEDESEESRRKVREERKKRRREAAPCDAGLGGLGS
GARALSQPESLLSVGLEGAVTQLPGAAQKKPKKRKRKISRSQESEGPEPGTSEGSQVVPG
AGPAEGWEEPCRLKKRAKKKRRRSSAESAPASGGGLSGCPTSFRDPLLDSLEGTGSSIEE
SMTPRPREEPTQECPQEVQRLGPADEENSVEWARDSEARHLSEDSEGADVDLASAVRQLR
EFIPGIGERAATTIKRMYRDDLGRFKEFKAQGVAIKFGKFSAKENQQLEKNVQEFLSLTG
IENADKLLYTDRYPEEKAAITDLKRKYAFRLHIGKGIARPWKLVYYRAKKMFDVNNYKGR
YSKGDMEKLKIYHSLHGNDWKKIGDLVARSSLSVALKFSQISSERNHGAWSKTETQKLIK
AVEEVILKKMSPQDLKEVDSKLQENPEGRLSIVREKLYKGISWVEVEAKVETRNWMQCKS
KWTEILTKRMTNGRDVYRGVNALQAKINLIERLYEINVEDANEIDWEDLAGTIGDVPPSY
VQTKFYKLKATCVPFWQKKTFPEIIDYLHETSLPLLREKLEKKMERGRARLQTPAAPRRA
FLFRDIFYCDRDSEDDDDGSGPS
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggaaggcgagtcgagcagatgggagatccgcactccagtttttgacaagaaaaagaag
aagtattctgtagataaggagagacacaggacgcatgcccaggaaggtttcagagacgtc
cccccagcaagcgaacagtctcacaaaacgaaaaaaaagagaaaggaccgccagcatttg
gcctcgtctgcttggaaagcaccagagctccttgaggagcccgaaaaggccgcttctgca
gccagaaggcggaggagcagcgccccggggttacaggacgaggcgggcgtgtgcatcctg
gtggacaaggcgaacatcgagaacacgtcgaagagccgtaggaggaatgttgacatcgtt
tatgttgacatgagcaaggaacaggaggcagccagagcgcccggagccgctgagccgcgt
gcagtttctaagcgacatgaagatgagtcggaagaatcacgcagaaaagtgagggaggaa
aggaaaaagcgtaggcgggaagctgcgccctgcgatgcggggctgggaggcctgggctcc
ggtgccagggccctgtcccagcccgagtccctgctctctgtgggcctcgaaggcgcggtc
acacagctgccaggggctgctcagaaaaagcctaagaaaagaaagagaaagatttcacgt
agccaggaatctgagggtcccgagcctgggacctcggagggctcgcaagtggtcccaggt
gcggggcctgcagagggctgggaagagccctgcaggttaaagaaaagggctaagaaaaag
aggcggaggtcttctgctgaaagcgccccagcttccggcggtgggctctcggggtgcccc
acgagcttcagggacccgctcctcgactcactggaaggcaccggctcctcgattgaggag
agcatgacaccccggccgcgagaggagccaacccaggagtgtccgcaagaggtgcagagg
ttaggacctgcagatgaagaaaacagcgtggaatgggctagagattctgaagctcggcat
ttgtctgaagactcggagggtgcagacgtggacctggcgtctgccgtgcggcagctccgg
gagttcatccccggcatcggggagagggcggccaccacgattaagcgcatgtaccgggat
gacttgggacggttcaaggagttcaaagcgcagggtgtcgccattaaatttggcaagttt
tctgcaaaggaaaatcagcagttagaaaaaaacgtgcaagaatttctgtccctgactgga
attgagaatgcggacaagctgctgtacacagacaggtacccagaggagaaggccgccatc
accgacctcaagagaaaatacgcatttagactgcacattggtaagggcatcgcccggccc
tggaaactcgtgtactaccgagccaagaagatgttcgatgtcaataattacaaaggcagg
tacagcaaaggggatatggagaagttaaaaatataccactccctccatggcaatgactgg
aaaaagattggggacttggtggctcgaagcagcctctccgttgccctgaagttctcccag
atcagcagtgaaagaaatcatggcgcttggagtaagacggaaacccagaaactaatcaag
gctgttgaagaagtgattctaaagaaaatgtctccccaggatttaaaagaggtagattct
aaactccaagaaaatcctgagggccgcctgtcaattgttcgggaaaaactctacaagggc
atatcttgggtagaagtcgaagccaaagtagaaaccagaaactggatgcagtgtaaaagt
aagtggacggagattctcaccaagaggatgacgaatggccgggacgtgtaccgcggagtg
aacgccctgcaggccaaaatcaacctgatcgagaggttgtatgaaataaatgtggaggat
gctaatgaaatagactgggaagatctggctggtaccataggggatgttcctccgtcttat
gttcaaactaaattttataagctgaaagcgacctgtgttcccttctggcagaagaagact
ttcccagagattatcgactaccttcatgagacgagcctgcctctgctcagagagaagctg
gagaagaagatggagagaggccgcgcgaggctgcagacgcctgcggcgcccaggcgcgcc
ttcctgttcagggacatcttctactgcgacagagacagcgaggacgacgacgacgggagt
gggccgagttag

DBGET integrated database retrieval system