KEGG   Miniopterus natalensis: 107524660
Entry
107524660         CDS       T05883                                 

Gene name
BCAR1
Definition
(RefSeq) breast cancer anti-estrogen resistance protein 1 isoform X1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04062  Chemokine signaling pathway
mna04510  Focal adhesion
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna04935  Growth hormone synthesis, secretion and action
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107524660 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107524660 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107524660 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107524660 (BCAR1)
   04062 Chemokine signaling pathway
    107524660 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107524660 (BCAR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107524660 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    107524660 (BCAR1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107524660 (BCAR1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2 Vinculin
Other DBs
NCBI-GeneID: 107524660
NCBI-ProteinID: XP_016052123
LinkDB
Position
Unknown
AA seq 868 aa
MEDKENVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNR
LKILVGMHDKKPAGPGPGPPASLAQPQPGLHNPAAQYTPMLPVAYPPQPDSVYLVPTPSK
TQQGLYQVPGPSPQFQSPPAKQTSTFSKQMPHHPFPSPAPDLYQVPPGPGNSTQDIYQVP
PSAGIGHEIYQVPPSMDARSWEGTKPPPKVVVPTRVGQGYVFEASQPEQDEYDIPRHLLG
PAPQDIYDVPPVRGLLPSQYSQEVYDTPPMAVKGPNGWDPSLDVYDVPPSVEKSLPTSSH
HSVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPTLHPLVLAAPPPDPPSAEDVY
DVPPPAPDLYDVPPGLRRPGPSALYDVPRERALPPEVADSSVADDGVYVVPPPAEREAPA
DAKRLSASSTGSTRSSQSASSLEAPVPGREPLELEVAVEALTRLQQGVSATVAHLLDVAG
SAGRSGGWRSTTEPQEPLAQDLRAAVAAVQGAVHELLEFARSAVGNAAHTSDRTLNAKLS
RQLQKMEDVYQTLVAHGQTFDSSRGGTGATSEDLDRLVACSRAVPEDAKQLASFLHGNAS
LLFRRTKAPASGPEGGGPLHPNPTDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGWME
DYDYVHLQGKEEFEKTQKELLEKGNIIRQGKGQLELQQLKQFERLEQEVSRPIDHDLTNW
TSAQPLAPGRTGSLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHS
KFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPAA
AQDMVDRVKELGHSTQQFRRVLGQLAAA
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggaggacaaagagaatgtgctggccaaagccctctacgacaatgtggccgagtccccg
gatgagctctccttccgcaagggcgatatcatgacggtgctggagcgggacacacagggc
ctggacggctggtggctctgctcactgcatgggcgccaaggcattgtgcccgggaaccgc
ctcaagatcctggtgggcatgcacgacaagaagcctgcaggacccggccccggcccacct
gcctccttggcccagccccagcctggcctccacaacccggctgcccagtacacgcccatg
ctgcctgttgcttacccaccccagcctgacagtgtctacctggtgccgaccccaagcaag
acccagcagggcctctatcaagtccccgggcccagcccacagttccagtctcccccagcc
aagcagacgtccacgttctcgaagcagatgccccatcacccattccccagcccagctcca
gacctgtaccaggtgcctccagggcctggcaactctacccaggacatttaccaggtgcca
ccttctgctggaatagggcatgaaatctaccaggttcccccatccatggatgcacgcagc
tgggaaggaacaaagcccccgccaaaggtggtggtgcctacccgcgtgggacagggctat
gtgttcgaggcctctcagccagagcaggacgagtatgacatcccacgccacctgctgggc
ccagcgccccaggacatctacgacgtgccccctgttcgagggctgcttcccagccagtac
agccaggaggtatatgacacacctcccatggccgtcaagggtcccaatggctgggaccca
tcactggacgtgtatgacgtgcccccaagtgtggagaagagcctgccaacatccagccac
cactcggtgtatgatgttcctccgtcggtgagcaaggacgtccctgatggcccgctactg
cgtgaagaaacctatgatgtgccccctgcctttgccaaggccaagccctttgacccaacc
ctccacccgctggtccttgctgcaccccctccagacccgccgtccgctgaggatgtgtat
gacgtgccaccgcctgctcccgacctctatgacgtgccccctggcttgcggcggcctggc
cccagcgccctgtacgacgtgccccgcgagcgggctcttcctcctgaggtggctgatagc
agcgtggccgatgacggtgtgtacgtggtgccacccccagctgagcgagaggccccagcc
gatgccaagcgcctgtctgcctccagcacaggcagcactcgcagcagccagtcggcctcc
tccctggaggcgccagtgccgggccgtgagcccctggagctggaggtggccgtggaggcc
ctgacccggctgcagcagggtgtgagtgccactgtagcccacctcttggatgtggcgggc
agtgctggccggagtgggggctggcgcagcaccacagagcctcaggagcccctggctcag
gacctgcgggctgctgtggctgccgtccagggggctgtccatgagctgctagagtttgcc
cgcagtgctgtgggcaacgctgcccacacttctgaccgcacactgaatgccaagcttagc
cggcaactgcagaagatggaggacgtgtaccagacattggtggctcatggtcagaccttt
gacagtagccggggaggtactggggccacttctgaagacctggaccgcctggtggcctgc
tcacgggctgtacccgaggacgccaagcagctggcctccttcttgcacggcaatgcctcg
ctgctcttcagacggaccaaggctcctgcctcagggcctgaggggggaggccccctgcat
cccaaccccactgacaaggccagcagcatccagtcccggcccctgccctcaccccccaag
ttcacctcccaggactcaccggatgggcagtacgagaacagcgaggggggctggatggag
gattacgactatgtccacctgcaggggaaggaggagtttgagaagactcagaaggagctg
ttggaaaagggcaacatcattcggcaggggaagggccagctggagctgcagcagctgaag
cagtttgagcggctggagcaggaggtgtcacggcccatagaccacgacctgaccaactgg
acatcagcccagcccctggccccagggcggacaggcagcctggggccctcggaccgacaa
ctgctgctcttctacctagagcagtgcgaggcgaacctgaccacgctcaccaacgcggtg
gacgccttctttaccgccgtggccaccaaccagccgcccaagatctttgtggcacacagc
aagtttgtcatcctcagcgcccataagctggtgttcatcggggacacgctgtcacgccag
gccaaggcagctgacgtccgaagccaggtgactcactacagcaacttgctgtgtgacctc
ctgcgtggcattgtagccaccaccaaggccgctgccctgcagtacccatcacccgctgct
gcccaggacatggtggacagggtcaaggagctgggccacagcacccagcagttccgccgg
gtcctgggccagctggcagctgcctga

DBGET integrated database retrieval system