KEGG   Miniopterus natalensis: 107524668
Entry
107524668         CDS       T05883                                 

Gene name
VAV2
Definition
(RefSeq) guanine nucleotide exchange factor VAV2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05135  Yersinia infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107524668 (VAV2)
   04024 cAMP signaling pathway
    107524668 (VAV2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107524668 (VAV2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107524668 (VAV2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107524668 (VAV2)
   04660 T cell receptor signaling pathway
    107524668 (VAV2)
   04662 B cell receptor signaling pathway
    107524668 (VAV2)
   04664 Fc epsilon RI signaling pathway
    107524668 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    107524668 (VAV2)
   04670 Leukocyte transendothelial migration
    107524668 (VAV2)
   04062 Chemokine signaling pathway
    107524668 (VAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107524668 (VAV2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107524668 (VAV2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107524668 (VAV2)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107524668 (VAV2)
SSDB
Motif
Pfam: RhoGEF SH3_2 SH3_1 SH3_9 SH2 C1_1 PH CH CAMSAP_CH PH_10 SH2_2 Zn_ribbon_17 C1_2
Other DBs
NCBI-GeneID: 107524668
NCBI-ProteinID: XP_016052135
LinkDB
Position
Unknown
AA seq 826 aa
MEANCMIELQGARASQLPAGAGSSLQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDV
RDFGKVISAVSRLSLHNVAQNKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCV
PCEDEGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMAP
LRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSMMGGGSSLAKVFLEFKERLLIYGEYC
SHMEHAQNTLNQLLASREDFRVKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSTDRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPK
IDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRRGYSYELKEIIELLFHKVTDDPMNNKDV
KKWSYGFYLIHLQGKQGFQFFCKTEDTKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACRMFLRGTFYQGYLCTKCGVGAHKECLEVTPPCKISSPADLDASGAGPGPKMV
AVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPESQWWEGRLVQTRKSGYFPSTSVKPCPV
DGRPPIGRLPSREIDYGAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKSRER
AASRSSSRSPASCASYNFSFLSPQGLSFASQGSSAPFWSVFTPRVIGTAVARYNFAARDM
RELSLREGDVVKIYSRIGGDQGWWRGETNGRIGWFPSTYVEEEGIQ
NT seq 2481 nt   +upstreamnt  +downstreamnt
atggaggccaattgcatgatcgagctgcaaggggcgagggcgtctcagctgcctgcaggt
gctggctccagcctgcagttcctctgtttgaagaacatacgcactttccttaaagtatgc
cacgataaatttggattaagaaacagtgagctgttcgaccccttcgacctctttgatgtc
cgagactttgggaaggtcatctctgcggtgtccagactgtccctgcacaatgtggcccag
aacaaagggatcaggccttttccctccgaggagacggcagaaaacgatgatgacgtctac
cgcagcctggaggagctggctgatgagcacgacctgggggaggacatctatgactgcgtc
ccgtgtgaagatgaaggggacgacatctacgaggacatcatcaaggtggaggtgcagcag
cccatgaaaatgggcatgaccgaggacgacaagaggaactgctgcttgctggagatccag
gagaccgaggccaagtactaccggacgctggaggacattgagaagaactacatggccccc
ctgaggctggtgctgagcccggcggacatggcagctgtcttcatcaacctggaggaccta
atcaaggtgcatcacagcttcctgagagccatcgacgtgtccatgatgggggggggcagc
agcctggccaaggtcttcctcgagttcaaggagaggctcctgatctacggggagtactgc
agccacatggaacacgcccagaacacgctgaaccagctcctcgccagccgggaggacttc
agagtaaaagtcgaggaatgcacgctgaaggtccaggacgggaagttcaagctgcaggac
ctgctggtggtgcccatgcagagggtgctcaagtatcacctcctcctgaaggaacttctg
agccattccactgaccggcctgagaggcagcagctgaaagaagcactggaagccatgcag
gacttggcaatgtacataaatgaagttaaacgggacaaagagaccctaaagaaaatcagc
gagtttcagagttctatagaaaacttgcaagtgaagctggaggaatttgggaggccaaag
atcgacggggagctgaaggtccgctccatagtcaaccacaccaagcaagacaggtacctg
ttcctgtttgacaaggtggtcatcgtctgcaaaaggaggggctacagctacgagctgaag
gagatcatcgagctgctcttccacaaggtgaccgatgaccccatgaacaacaaggatgtc
aagaagtggtcctacggcttctacctgatccacctgcaagggaaacagggctttcagttc
ttctgcaagacggaggacaccaagaggaaatggatggagcagttcgagatggccatgtcc
aacatcaagcccgacaaagccaacgccaatcaccacagcttccagatgtacacgttcgac
aagaccaccaactgcaaagcctgcaggatgttcctcaggggcaccttctaccaggggtac
ctgtgcaccaagtgtggcgtgggggcgcacaaggagtgtctagaagtgacgcctccctgc
aagatcagttcgcctgctgacctggatgcctctggagcgggaccaggtcccaagatggtg
gctgtgcagaattaccatggcaaccctgctccccccgggaagccagtgctgaccttccag
acaggcgatgtgattgagctgctaagaggggaccccgagtctcagtggtgggaggggcgg
ctggtgcagaccaggaagtcgggctacttccccagcacgtctgtgaagccctgccccgtg
gatggaaggccacccattggccggctgccatcccgggagatcgactatggtgcttacccc
tggtttgcaggcaacatggagaggcagcagacagacaacctgctcaaatcccacgccagc
gggacctacctgatcagggagcggccggccgaggccgagcgcttcgccataagcatcaag
ttcaacgacgaggtgaagcacatcaaggtggtagagaaagacagctggatccacatcaca
gaagcgaagaaatttgaaagcctcttggagttggtggagtactaccaatgccactctctc
aaggagagcttcaagcagctggacaccacactcaagtacccctacaagtctcgggaacgc
gcagcttccaggagctccagccggtccccagcttcctgcgcctcctacaacttttctttt
ctcagtcctcagggcctcagctttgcttctcagggctcctccgctcccttctggtcagtg
ttcacgccccgcgtcatcggcacggctgtggccaggtacaactttgctgcccgggacatg
cgggagctctcgctgcgggaaggcgatgtggtgaagatctacagccgcattggcggggac
cagggctggtggaggggcgagacgaatggccggatcggctggtttccttcaacatatgta
gaagaggagggcatccagtga

KEGG   Miniopterus natalensis: 107525716
Entry
107525716         CDS       T05883                                 

Gene name
VAV1
Definition
(RefSeq) proto-oncogene vav
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05135  Yersinia infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107525716 (VAV1)
   04024 cAMP signaling pathway
    107525716 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107525716 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107525716 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107525716 (VAV1)
   04660 T cell receptor signaling pathway
    107525716 (VAV1)
   04662 B cell receptor signaling pathway
    107525716 (VAV1)
   04664 Fc epsilon RI signaling pathway
    107525716 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    107525716 (VAV1)
   04670 Leukocyte transendothelial migration
    107525716 (VAV1)
   04062 Chemokine signaling pathway
    107525716 (VAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107525716 (VAV1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107525716 (VAV1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107525716 (VAV1)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107525716 (VAV1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH2 SH3_9 C1_1 PH CDC24 C1_2 LZ3wCH PH_16
Other DBs
NCBI-GeneID: 107525716
NCBI-ProteinID: XP_016053437
LinkDB
Position
Unknown
AA seq 845 aa
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEEESMGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRT
EPGPMPPKMTEHDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPEDIEIIFINI
EDLLRVHTHFLKEMKEALATTGAPTLYQVFIKYKERFLVYGRYCSQVESASKHLDRVANA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGERDNKKWTHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGQDFAGTMKKDRPYRRAQDKRRNELGLPKMEVC
QEYYGLPPPPGAFGPFLRLNPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCDRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPERRAISKPAAGS
TKYFGTAKVRYDFCARDRSELNLKEGDIVKILNKKGQQGWWRGEIYGRVGWFPSNYVEED
YSEYC
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggagctgtggcgacagtgcacccactggctgatccagtgccgggtgctgccgcccagc
caccgtgtgacctgggacggggcccaggtgtgcgagctggcacaggcccttcgggatggg
gtccttctctgccagctgcttaacaacctgctgccccacgccatcaacttacgcgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacatccgtaccttcttgtct
acctgctgtgagaagtttggcctcaagaggagtgagctctttgaggccttcgacctcttc
gatgtgcaggatttcgggaaggtcatctacaccctgtctgctctgtcctggaccccgatt
gcccagaacaaggggatcatgcccttccccaccgaggaggagagcatgggggatgaagac
atctacagcggcctgtccgaccagatcgatgacacggtggaggaagacgaggacctgtac
gactgcgtggagaacgaggaggcggagggcgacgagatctacgaggacctgatgcgcacg
gagccggggcccatgccgcccaagatgacagagcacgacaagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtacacggacacgctgggctccatccagcagcacttc
atgaagcccctgcaacggtttctcaaacccgaagacatagagatcatcttcatcaacatc
gaggacctgcttcgtgtgcacactcacttcctaaaggagatgaaggaagccctggccacc
accggagcacctaccctctaccaggtcttcatcaagtacaaggagaggttccttgtctat
ggccgctactgcagccaggtggagtcggccagcaagcacctggaccgtgtggccaacgcc
cgggaggatgtacagatgaagctggaggaatgttctcagcgagcaaacaatgggaggttc
accttgcgggacctgctgatggtgccaatgcagcgagtgctcaagtaccacctacttctc
caggagctggtgaaacacacgcaggacgcaatggagaaggagaatctgcggctggccctg
gacgcaatgagggacctggcacagtgtgtgaatgaggtcaagcgggacaatgagaccctg
cggcagatcaccaacttccagctgtccattgagaacctggaccagtctctagcccactat
ggccggcccaagatcgatggggagctcaagatcacctcggtggagcgccgctccaagatg
gacaggtacgccttcctgctcgacaaagctctgctcatctgcaagcgccgaggggactcc
tatgacctcaaggactttgtgaacctgcacagcttccaggttcgagatgactcttcagga
gagcgtgacaacaagaagtggactcacatgtttctcctgatcgaggaccaaggtgctcag
ggctatgagctgttcttcaagacacgagaactgaagaagaagtggatggagcagttcgag
atggccatctccaacatctaccctgagaatgctacagccaacggacatgacttccagatg
ttctccttcgaggagaccacgtcctgcaaggcttgccagatgctgctgagaggcaccttc
tatcagggctaccgttgtcatcggtgccgggcacctgcacacaaagagtgtctggggagg
gtccctccctgtggccgccatgggcaagattttgctggaactatgaagaaggacaggccg
tatcgccgggctcaggacaaaaggaggaatgagctggggctgccgaagatggaggtttgc
caggagtactatgggcttcctccgcccccgggagcctttggaccttttctacggctcaac
cctggagacattgtggagctcaccaaggccgaggctgaacagaactggtgggagggcagg
aatacagctaccaatgaagttggctggtttccctgcgacagggtcaagccctatgtgcat
ggcccccctcaggacctgtccgtccatctctggtacgctggccccatggagcgtgctgga
gcagaaagcatcctcaccaaccgctcggatgggacattcttggtgaggcagagggtgaag
gacgcagcggaatttgccatcagcattaagtataatgttgaggtcaagcacattaaaatc
atgacggcagaaggactgtaccggattacagaaaagaaggctttccgggggctgacggag
ctggtggagttttaccagcagaactccctaaaggattgcttcaagtcgctggacaccacc
ctgcagtttcccttcaaggagccagagaggagagccatcagcaaaccagcagcaggaagc
accaagtattttggcacagccaaagttcgctacgacttctgcgccagggatcgatcagag
ctgaacctcaaggagggtgacattgtcaagatccttaacaagaaggggcaacaaggctgg
tggcgaggggagatctatggccgggttggctggtttccctctaactatgtggaggaagat
tattccgaatactgctga

KEGG   Miniopterus natalensis: 107537179
Entry
107537179         CDS       T05883                                 

Definition
(RefSeq) guanine nucleotide exchange factor VAV3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05135  Yersinia infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107537179
   04024 cAMP signaling pathway
    107537179
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107537179
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107537179
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107537179
   04660 T cell receptor signaling pathway
    107537179
   04662 B cell receptor signaling pathway
    107537179
   04664 Fc epsilon RI signaling pathway
    107537179
   04666 Fc gamma R-mediated phagocytosis
    107537179
   04670 Leukocyte transendothelial migration
    107537179
   04062 Chemokine signaling pathway
    107537179
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107537179
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107537179
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107537179
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107537179
SSDB
Motif
Pfam: SH3_2 SH3_1 SH3_9 SH2 Filamin SH2_2 SH3_3
Other DBs
NCBI-GeneID: 107537179
NCBI-ProteinID: XP_016068612
LinkDB
Position
Unknown
AA seq 251 aa
MQVIRSYAGTPPPALHEGPPLHIQAGDTVELMRGDAHSLFWQGRNLASGEVGFFPSDAVK
PCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEA
KHIKIVTRDGLFHIAENRKFRSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQR
GSRVGNSLLSPKVLGIAVARYDFCARDMRELSLLKGDVVKIYTKMSGNGWWRGEVNGKVG
WFPSTYVEIDE
NT seq 756 nt   +upstreamnt  +downstreamnt
atgcaggtgatcaggagctatgctgggacgccaccccccgccctccacgaagggcccccg
ctgcacatccaggccggggacaccgtcgagctgatgcggggagacgcgcacagcctgttc
tggcagggtagaaatctagcatctggagaggttggatttttcccaagtgatgctgtcaag
ccctgtccatgcgtgcccaaaccagtagattattcttgccaaccttggtatgccggagct
atggagaggttgcaggcagagaccgaacttattaatagggtgaacagtacttacctggtg
aggcacaggaccaaagagtcaggagaatatgccattagcattaagtacaataatgaagcc
aagcacatcaagattgtaacaagagacggcttattccacattgcagaaaacagaaaattc
agaagtttaatggaactcgtggagtattacaagcatcactccctgaaagaggggttcaga
accttggatacgaccctgcagtttccctacaaggagccggagcactcagctggacagagg
gggagcagagtgggcaacagcttgttgagtccaaaggtgctgggcatcgccgtcgcccgc
tacgacttctgcgcgagggacatgcgggaactgtccctgctgaaaggagacgtggtgaag
atttacaccaagatgagtggcaacggctggtggagaggagaagtgaacggcaaggtgggc
tggtttccatccacgtatgtggaaatagatgagtag

KEGG   Miniopterus natalensis: 107541170
Entry
107541170         CDS       T05883                                 

Gene name
VAV3
Definition
(RefSeq) guanine nucleotide exchange factor VAV3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05135  Yersinia infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107541170 (VAV3)
   04024 cAMP signaling pathway
    107541170 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107541170 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107541170 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107541170 (VAV3)
   04660 T cell receptor signaling pathway
    107541170 (VAV3)
   04662 B cell receptor signaling pathway
    107541170 (VAV3)
   04664 Fc epsilon RI signaling pathway
    107541170 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    107541170 (VAV3)
   04670 Leukocyte transendothelial migration
    107541170 (VAV3)
   04062 Chemokine signaling pathway
    107541170 (VAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107541170 (VAV3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107541170 (VAV3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107541170 (VAV3)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107541170 (VAV3)
SSDB
Motif
Pfam: RhoGEF CAMSAP_CH CH C1_1 PH CDC24 PH_16 PH_10 C1_2 LZ3wCH zf-RING-like Prok-RING_1
Other DBs
NCBI-GeneID: 107541170
NCBI-ProteinID: XP_016073655
LinkDB
Position
Unknown
AA seq 667 aa
MAHVLLGLLDDHTAVLSSLLQNVHRTLMPWRQCAQWLIHCKVLPANHRVTWDSAQVFDLA
QTLRDGVLLCQLLNNLRARSINLKEINLRPQMSQFLCLKNIRTFLLACCETFGMRKSELF
EAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESVTDEDIYKALPDLIDETHVE
DAEGLYDCVYGEDEGGEVYEDLMKAEEAHPPKCPENDIRYCCLAEIKQTEEKYTETLESI
EKYFMAPLKRFLTAAEFDSVFVNIPELVKVHRNLMQEIHDSIVNKNDQNLYQIFINYKER
LVIYGQYCSAVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKY
HLLLQELVKHTTDPLEKANLRLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQP
VLLFGRPQGDGEIRMTTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIAN
NPTTDKENKKWSYGFYLIHTQGHNGLEFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFH
EFKMHTFSRVTSCKACQMLLRGTFYQGYLCFKCGARAHKECLGRVDNCGVTSAEPGMLKA
LEKRTNGLRRTPRPVDPGVSLALRRGYDLVAFDVSLELCVRLELVVFGIFASFSRKSHRR
VSVNPAR
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggcccacgttcttctggggctgcttgatgaccacacagctgtgctctcctctctgctg
cagaatgtgcacaggacgctgatgccgtggcggcagtgcgcgcagtggctcatccactgc
aaggtgctgcccgccaaccaccgggtgacctgggactcggcgcaggtgttcgacctggcg
cagaccctccgcgatggagtcctcctgtgccagctgctcaacaacctccgggcgcgctcc
atcaacctgaaggagatcaacctgaggccgcagatgtcccagtttctctgtctgaagaat
atacggaccttcctcttggcctgttgcgagacgtttggcatgagaaagagtgaactcttc
gaggcctttgacctgtttgatgtccgggactttggaaaggtgatagaaaccttgtcgcga
ctttcccggaccccgatagcgttggccacgggaatcaggcccttcccaacagaagagagc
gtgaccgatgaagacatctacaaggccctgcccgacttgatagatgagacccacgtggag
gatgccgagggcctgtacgactgcgtttacggcgaggacgaaggtggcgaggtctatgag
gacctgatgaaagccgaggaagcccatccgcccaaatgtccagaaaatgacatacgatat
tgctgcctagcagaaattaagcagacagaagaaaaatatacagaaacactggaatcaata
gagaaatacttcatggcgccactgaaacggttcctgacagcagcagagtttgactcagtc
ttcgtcaacattcctgagcttgtaaaagttcatcggaacctcatgcaagaaattcacgat
tccattgtaaataagaatgaccagaacttgtatcagattttcatcaactacaaggaaagg
ttggttatttacgggcagtactgcagcgccgtggagtccgccatctccagtttagactac
atctccaagactaaagaagacgtcaagctgaaattagaggaatgttccaagcgcgccaac
aacgggaagttcaccctccgagacctgcttgtggtcccgatgcagcgcgttctgaagtat
catctcctgctccaggagctggtcaagcatacgacggaccccctggagaaggcgaacctg
agactggcccttgacgcgatgaaggacttggcgcagtatgtgaacgaagtgaagagagat
aacgagaccctgcgtgaaattaaacagtttcagctctctatagaaaacctgaaccaacca
gttctgctctttggacggcctcagggagatggtgaaattcgaatgaccactttggacaag
cacacgaaacaagaaaggcacatcttcctatttgacttggcagtgatcgtatgcaaaagg
aaaggcgataactatgaaatgaaggagataatagatcttcagcagtacaaaatcgccaac
aatcctacaactgataaagaaaataaaaagtggtcttatggcttctacctcatccatacc
caaggacacaatgggttagaattttattgcaaaacaaaagacttaaagaagaaatggctg
gagcagtttgaaatggctttgtctaacataaggcctgactatgctgactccaatttccat
gagtttaagatgcacaccttcagccgggtgacctcctgcaaggcctgccagatgctcctc
aggggaacgttttaccaaggctatttatgtttcaagtgtggtgctagggcacacaaagaa
tgtctgggaagagtcgacaactgcggcgtcacttctgccgagccggggatgctcaaagca
ctggagaaacggaccaatgggctgcgaaggacccccaggccggtggatccaggtgtgtct
ctggccctgcgtcgtggttatgacttagtggcttttgacgttagcctggagttgtgtgtg
cgtctggagttggttgtctttggtatcttcgcctctttctctcgcaagtcgcaccgccgt
gttagcgttaaccctgctcgatga

DBGET integrated database retrieval system