KEGG   Miniopterus natalensis: 107524712
Entry
107524712         CDS       T05883                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04380  Osteoclast differentiation
mna04612  Antigen processing and presentation
mna04668  TNF signaling pathway
mna04710  Circadian rhythm
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04931  Insulin resistance
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04962  Vasopressin-regulated water reabsorption
mna05016  Huntington disease
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05203  Viral carcinogenesis
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107524712 (CREB1)
   04024 cAMP signaling pathway
    107524712 (CREB1)
   04022 cGMP-PKG signaling pathway
    107524712 (CREB1)
   04151 PI3K-Akt signaling pathway
    107524712 (CREB1)
   04152 AMPK signaling pathway
    107524712 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107524712 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    107524712 (CREB1)
   04922 Glucagon signaling pathway
    107524712 (CREB1)
   04915 Estrogen signaling pathway
    107524712 (CREB1)
   04926 Relaxin signaling pathway
    107524712 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    107524712 (CREB1)
   04918 Thyroid hormone synthesis
    107524712 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    107524712 (CREB1)
   04916 Melanogenesis
    107524712 (CREB1)
   04924 Renin secretion
    107524712 (CREB1)
   04925 Aldosterone synthesis and secretion
    107524712 (CREB1)
   04927 Cortisol synthesis and secretion
    107524712 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107524712 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107524712 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    107524712 (CREB1)
   04728 Dopaminergic synapse
    107524712 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107524712 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    107524712 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107524712 (CREB1)
   04713 Circadian entrainment
    107524712 (CREB1)
   04714 Thermogenesis
    107524712 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107524712 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107524712 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107524712 (CREB1)
   05020 Prion disease
    107524712 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    107524712 (CREB1)
   05031 Amphetamine addiction
    107524712 (CREB1)
   05034 Alcoholism
    107524712 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107524712 (CREB1)
   04934 Cushing syndrome
    107524712 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107524712 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107524712 (CREB1)
   05161 Hepatitis B
    107524712 (CREB1)
   05163 Human cytomegalovirus infection
    107524712 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107524712 (CREB1)
   05165 Human papillomavirus infection
    107524712 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107524712 (CREB1)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107524712 (CREB1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107524712 (CREB1)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    107524712 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 107524712
NCBI-ProteinID: XP_016052193
LinkDB
Position
Unknown
AA seq 327 aa
MTMESGAENQQSGDAAVTEAENQQMTVQSQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccagcaaatgacagttcaatcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaacattagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagatttcaactattgcagaaagtgaagattcacaagagtca
gtggatagtgtaactgattcccaaaaacgaagagaaattctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggagtgccaagaattgaagaagag
aagtctgaagaggagacttcagcacctgccatcaccactgtaacggtgccaactccaatt
taccaaactagcagtggacagtatattgccattacccagggaggagcaatacaactggct
aacaatggtacagatggggtacagggcctgcaaacattaaccatgaccaatgcagctgcc
actcaaccgggtactaccattctacagtacgcacagaccactgatggccagcagatctta
gtacccagcaaccaagttgttgttcaagctgcctctggagatgtacaaacataccagatt
cgcacagcacccactagcaccattgcccctggagtagttatggcatcctccccagcgctt
cctacacagcccgctgaagaagccgcacggaagagagaggttcgcctaatgaagaacagg
gaagcagcacgagagtgtcgtagaaagaagaaagaatatgtgaaatgtttagaaaacaga
gtggcagtgcttgaaaaccaaaacaagacactgattgaggagctaaaagcacttaaggac
ctttactgccacaaatcagattaa

KEGG   Miniopterus natalensis: 107525737
Entry
107525737         CDS       T05883                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04668  TNF signaling pathway
mna04714  Thermogenesis
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04931  Insulin resistance
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04962  Vasopressin-regulated water reabsorption
mna05016  Huntington disease
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107525737 (CREB3L3)
   04024 cAMP signaling pathway
    107525737 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    107525737 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    107525737 (CREB3L3)
   04152 AMPK signaling pathway
    107525737 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107525737 (CREB3L3)
   04922 Glucagon signaling pathway
    107525737 (CREB3L3)
   04915 Estrogen signaling pathway
    107525737 (CREB3L3)
   04926 Relaxin signaling pathway
    107525737 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    107525737 (CREB3L3)
   04918 Thyroid hormone synthesis
    107525737 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    107525737 (CREB3L3)
   04916 Melanogenesis
    107525737 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    107525737 (CREB3L3)
   04927 Cortisol synthesis and secretion
    107525737 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107525737 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107525737 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    107525737 (CREB3L3)
   04728 Dopaminergic synapse
    107525737 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    107525737 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    107525737 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107525737 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    107525737 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107525737 (CREB3L3)
   05020 Prion disease
    107525737 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    107525737 (CREB3L3)
   05031 Amphetamine addiction
    107525737 (CREB3L3)
   05034 Alcoholism
    107525737 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107525737 (CREB3L3)
   04934 Cushing syndrome
    107525737 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107525737 (CREB3L3)
   05161 Hepatitis B
    107525737 (CREB3L3)
   05163 Human cytomegalovirus infection
    107525737 (CREB3L3)
   05165 Human papillomavirus infection
    107525737 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107525737 (CREB3L3)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107525737 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf KASH_CCD ZapB Jnk-SapK_ap_N pEK499_p136 DUF1664 SOGA ADIP DUF2207 DUF4407
Other DBs
NCBI-GeneID: 107525737
NCBI-ProteinID: XP_016053458
LinkDB
Position
Unknown
AA seq 459 aa
MNGDLAAGKMTSSTCAMGPIDSLELLDLLFDQQDGILRHVDLGEGWGHAGDQQVLPAPDS
NDFLNCILGSGDSVPSSPLWSPADSDSGISEDLPSDPQDTPPHNGLAATPAGCHFSESGK
GLCPSYHPVPHNPTKPLGPVAQVLEASVAIDLEMWNPELYPEEQTELAVSPPSCNLTVKD
LLLSGSGGDLQQQHLAGPHPLRSGTGNCQELMLTEDEKKLLAKEGITLPTQLPLTKYEER
VLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNRSLLEQ
LKKLQAIVVQSTSKSAQAGTCIAVLLLSFALIVLPSISPFAPNKAESPGDFTPVRVFSRT
LHNDAASRVALDTTPGSEAPGPQPEAGAPQGGSPGSPRVHWKSQDMLDLDNSMEEMNKST
LVQDNWTEELSRSTLLDWASPEPALSPGRVGLEAVGEEL
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaatggagatttagcagctggaaagatgacttcctccacctgtgccatgggccccatc
gacagcctggagctcctggatctcctgtttgatcagcaggatggaatcctgagacacgta
gatctgggcgagggttggggccatgctggagaccagcaggtcctgccagccccggactcc
aatgatttcctcaattgtatcttgggttctggagactcagtgcccagctctcctctctgg
tctcctgcggacagtgacagcggcatctctgaagatctgccctcagacccccaggatacc
cctccacacaatgggctggccgccaccccagctggctgccatttctcggagtctggcaag
gggctctgcccctcctaccatcctgttccccacaaccctaccaagccccttgggccagtg
gcccaagtgctcgaggcctctgtggccatagacctggaaatgtggaacccggagctctat
cctgaggagcagactgagctggcagtctcgcccccaagctgcaacctcacagtgaaagac
cttctcctctccggcagtggcggggacctgcaacagcagcatctggcaggcccccacccg
ttgagatcagggactgggaactgccaggagctgatgctgacagaggatgaaaagaaactg
ttggccaaagaaggcatcacgctgcccactcagctgccccttaccaagtatgaggagcga
gtgctgaaaaaaatccgcaggaaaatccgaaacaaacagtcagcccaagaaagccggaaa
aagaagaaggaatatattgatggcctggaaactcggatgtcagcctgcactgcccagaac
caggagcttcagaggaaagtcttgcatcttgagaagcagaatcggtccctcttggagcag
ctgaagaaactacaggccattgtggtccagtccaccagcaagtcagcccaggcaggcacc
tgcatagcggtcctgctgctctcttttgccctcatcgtcctcccctccatcagccctttt
gcccccaacaaagccgagagtcccggagacttcacaccggtgcgagttttctccagaact
ttgcacaacgacgctgcttcccgtgtggccctcgacaccacaccaggttccgaggcccca
ggtcctcagcccgaggctggcgcaccccagggagggtctccaggcagccccagggtacac
tggaaatctcaggatatgctggatctagacaactcgatggaggaaatgaacaagtcgacc
ctggtccaggacaactggacagaggagctgagccggtctaccctgctggactgggcctcg
cctgagccagcactcagcccaggccgcgtggggctggaggcagtgggggaggagctgtga

KEGG   Miniopterus natalensis: 107530327
Entry
107530327         CDS       T05883                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04668  TNF signaling pathway
mna04714  Thermogenesis
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04931  Insulin resistance
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04962  Vasopressin-regulated water reabsorption
mna05016  Huntington disease
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107530327 (CREB3L1)
   04024 cAMP signaling pathway
    107530327 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    107530327 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    107530327 (CREB3L1)
   04152 AMPK signaling pathway
    107530327 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107530327 (CREB3L1)
   04922 Glucagon signaling pathway
    107530327 (CREB3L1)
   04915 Estrogen signaling pathway
    107530327 (CREB3L1)
   04926 Relaxin signaling pathway
    107530327 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    107530327 (CREB3L1)
   04918 Thyroid hormone synthesis
    107530327 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    107530327 (CREB3L1)
   04916 Melanogenesis
    107530327 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    107530327 (CREB3L1)
   04927 Cortisol synthesis and secretion
    107530327 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107530327 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107530327 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    107530327 (CREB3L1)
   04728 Dopaminergic synapse
    107530327 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    107530327 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107530327 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107530327 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107530327 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107530327 (CREB3L1)
   05020 Prion disease
    107530327 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    107530327 (CREB3L1)
   05031 Amphetamine addiction
    107530327 (CREB3L1)
   05034 Alcoholism
    107530327 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107530327 (CREB3L1)
   04934 Cushing syndrome
    107530327 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107530327 (CREB3L1)
   05161 Hepatitis B
    107530327 (CREB3L1)
   05163 Human cytomegalovirus infection
    107530327 (CREB3L1)
   05165 Human papillomavirus infection
    107530327 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107530327 (CREB3L1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107530327 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Jnk-SapK_ap_N ELP6 TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 107530327
NCBI-ProteinID: XP_016059538
LinkDB
Position
Unknown
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEHGAWVLG
HKLCSVMVKQEQSLELPVDPLAASSAMAAAAAMATTPLLGLSPLSRLPVPHQAPGEMTQL
PMIKAEPQEMNQFLKVTPDDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLMPCLPEFSSGSQTVKEDPMATDSGYTASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPAEQRPQDHLQHDHLDSTHETTK
YLSEAWPKDISGNGTSPDFSHPKEWFHERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacagactgttccccggatccagcttcctg
gacttgggggacctgaacgagtcggatttcctcaacaatgcgcacttccctgagcacctg
gaccacttcgcggagaacatggaggacttctccaacgacctgttcagcagtttctttgat
gaccccgtgctggatgagaagagccctctgctggacatggaactggactcccccacgcca
ggcatccaggccgagcacagctactccctgagtggggactctgcgccccagagccccctc
gtacccatcaagatggaagacaccacccaagatgtggaacatggagcctgggtgctggga
cacaaattgtgctccgtcatggtgaagcaggagcagagcctggagctgcctgtggaccct
ctggccgcctcctcagccatggctgccgctgccgccatggccaccaccccgctgctgggc
ctcagccccctgtccaggctgcctgtcccccaccaggctccaggagagatgactcagctg
cccatgatcaaagcagagccccaggagatgaaccagttcctcaaagtgacaccagacgac
ctggtgcagatgcctccgacgccccccagcagccatggaagtgacagtgacggctctcag
agtccccgctctctgcccccttccagccctgtccggcccatggcccgctcctccactgcc
atctccacctctcccctcctcacagccccacataaattacaggggacttcggggccactg
ctgctgacggaggaggagaagcgcaccctgattgctgagggctaccccatccccacgaaa
ctgcccctcaccaaagccgaggagaaggccttgaagagggtccgtaggaaaatcaagaac
aagatctcggcccaggagagccgccggaagaagaaggaatacgtggagtgtctagaaaag
aaggtggagacatttacatcagaaaacaacgaactctggaaaaaggtggagaccctggag
aatgccaacaggaccctgcttcagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccgtacaagatggctgccacccagaccgggacctgcctgatggtggcagcc
ttgtgctttgttctggtgctgggctccctcatgccctgcctccctgagttctcctccggc
tcccagactgtgaaggaagaccccatggccactgacagcggctacacagccagtcagatg
ccctcccgaagcctcctgttctacgatgagggggcaggctcttgggaggatggccgcagt
gccctgctgcctgtggagcccccggatggctgggaaatcaagcccggggggccagcagag
cagagaccccaggaccacctacagcacgaccacctggacagcacccacgagaccacaaag
tacctgagcgaagcctggcccaaagacatcagtggaaacggcaccagccccgacttctcc
caccccaaggagtggttccatgagagggatctgggcccaaacaccaccatcaagctctcc
tag

KEGG   Miniopterus natalensis: 107543873
Entry
107543873         CDS       T05883                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04668  TNF signaling pathway
mna04714  Thermogenesis
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04931  Insulin resistance
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04962  Vasopressin-regulated water reabsorption
mna05016  Huntington disease
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107543873 (CREB3L4)
   04024 cAMP signaling pathway
    107543873 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    107543873 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    107543873 (CREB3L4)
   04152 AMPK signaling pathway
    107543873 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107543873 (CREB3L4)
   04922 Glucagon signaling pathway
    107543873 (CREB3L4)
   04915 Estrogen signaling pathway
    107543873 (CREB3L4)
   04926 Relaxin signaling pathway
    107543873 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    107543873 (CREB3L4)
   04918 Thyroid hormone synthesis
    107543873 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    107543873 (CREB3L4)
   04916 Melanogenesis
    107543873 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    107543873 (CREB3L4)
   04927 Cortisol synthesis and secretion
    107543873 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107543873 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107543873 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    107543873 (CREB3L4)
   04728 Dopaminergic synapse
    107543873 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    107543873 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    107543873 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107543873 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    107543873 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107543873 (CREB3L4)
   05020 Prion disease
    107543873 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    107543873 (CREB3L4)
   05031 Amphetamine addiction
    107543873 (CREB3L4)
   05034 Alcoholism
    107543873 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107543873 (CREB3L4)
   04934 Cushing syndrome
    107543873 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107543873 (CREB3L4)
   05161 Hepatitis B
    107543873 (CREB3L4)
   05163 Human cytomegalovirus infection
    107543873 (CREB3L4)
   05165 Human papillomavirus infection
    107543873 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107543873 (CREB3L4)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107543873 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB HAUS-augmin3 Spc29 DUF4407 OmpH OppC_N Jnk-SapK_ap_N DUF4404 ADIP Atg14 EMP24_GP25L APG6_N JMY KASH_CCD DUF724 YabA
Other DBs
NCBI-GeneID: 107543873
NCBI-ProteinID: XP_016077070
LinkDB
Position
Unknown
AA seq 393 aa
MDFRTPDLLDVWLEPPDDILTGSFLELGLHCPPSEVPVTMIQEQGLQGWESSGAHACGLQ
ESEPEDFPKLFIDPNEVYCSEASPGSDSEISGDPGHPDSPPVPKAPSSPGLCEIVYETEA
LKKMQEEAGPTVGFISIQLDQWSPPFMVPDACMVSELPLDAHAHILPRAGTVNSVLPATL
LPCQTLFLTDEEKHLLGQEGISLPSHLPLTKTEERVLKKVRRKIRNKQSAQDSRRRKKEY
IEGLESKVAAFAAQNQELQKKIQELERHNISLVTQLRQLQMLITQTSNKAAQTSTCVLIL
LFSLALIILPSFSPFQGLPEAGSEDYQPHGVISRNILTHKDVTKNQESPEIESRSGGPPG
VKSANGSRTLLEKMRGKTGPSGHVRTVLHADEM
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggatttcagaacccctgacctgctggatgtgtggctggagcccccagacgatatctta
acaggatccttcctggagctgggactccactgtccaccttccgaggtcccagtgactatg
atacaagaacaggggctgcaaggctgggagtccagtggagcccatgcctgtggccttcaa
gagagtgaacctgaagatttcccgaagcttttcattgatcccaatgaagtgtactgctca
gaagcatctcctggcagtgacagtgaaatctctggggaccctggtcatccagacagtccc
cctgtccccaaggcacccagttcccctggcctctgtgagattgtttatgagacagaggcc
ctgaagaagatgcaagaggaagctgggccaactgtagggttcatctccattcagctagat
caatggagcccaccttttatggtgcctgatgcctgcatggtcagtgagctgccccttgat
gctcatgcccacatcctgcccagagcaggcactgtaaactcagtgcttcctgcaaccctg
ctaccctgtcaaaccttgttcctgacagatgaggaaaagcatctgctggggcaggaaggc
atttccctgccctcccacctgcctctcaccaagacagaggagagggtcctcaagaaggtc
aggaggaaaatccgtaacaagcagtcagctcaggacagtcgtcggcggaagaaagagtac
atcgagggactggagagcaaggtggctgcctttgctgcacagaaccaggaactacagaaa
aaaatccaggagctggagaggcacaacatctccctggtgactcaactccgccagctgcag
atgctcattactcaaacttccaacaaagctgcccagaccagcacttgtgttttgatcctt
cttttttccctggctctcatcatcctgcccagtttcagcccctttcaaggtctaccagaa
gctggttctgaggattaccagcctcatggagtgatttccagaaatatcctgactcacaag
gacgtaacaaaaaatcaggagtccccagagatagagtccagatcgggggggccacctggg
gtcaagagtgcaaatggctcaaggacactgcttgagaagatgcgagggaagacaggcccc
agtgggcacgtcagaactgtgctgcatgcagatgagatgtga

KEGG   Miniopterus natalensis: 107544136
Entry
107544136         CDS       T05883                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04668  TNF signaling pathway
mna04714  Thermogenesis
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04931  Insulin resistance
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04962  Vasopressin-regulated water reabsorption
mna05016  Huntington disease
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107544136 (CREB3L2)
   04024 cAMP signaling pathway
    107544136 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    107544136 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    107544136 (CREB3L2)
   04152 AMPK signaling pathway
    107544136 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107544136 (CREB3L2)
   04922 Glucagon signaling pathway
    107544136 (CREB3L2)
   04915 Estrogen signaling pathway
    107544136 (CREB3L2)
   04926 Relaxin signaling pathway
    107544136 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    107544136 (CREB3L2)
   04918 Thyroid hormone synthesis
    107544136 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    107544136 (CREB3L2)
   04916 Melanogenesis
    107544136 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    107544136 (CREB3L2)
   04927 Cortisol synthesis and secretion
    107544136 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107544136 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107544136 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    107544136 (CREB3L2)
   04728 Dopaminergic synapse
    107544136 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    107544136 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107544136 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107544136 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    107544136 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107544136 (CREB3L2)
   05020 Prion disease
    107544136 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    107544136 (CREB3L2)
   05031 Amphetamine addiction
    107544136 (CREB3L2)
   05034 Alcoholism
    107544136 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107544136 (CREB3L2)
   04934 Cushing syndrome
    107544136 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544136 (CREB3L2)
   05161 Hepatitis B
    107544136 (CREB3L2)
   05163 Human cytomegalovirus infection
    107544136 (CREB3L2)
   05165 Human papillomavirus infection
    107544136 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107544136 (CREB3L2)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107544136 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 107544136
NCBI-ProteinID: XP_016077407
LinkDB
Position
Unknown
AA seq 520 aa
MEVLESGEQGALQWDRKLSELSEPGDPEALLYHTHFSELLDEFSQNVLGQLLNDPFLSEK
TVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHVTSSDSFNDDEAESEKWYLSADF
PSTTIKTEPITEESPPGLVPSVTLTITAISTPFEKEEPPLEMDTGVDSSCQTVIPKIKLE
PHEVDRFLNFSPKEASVDHLHLPPTPPSSHSSDSEGSLSPNPRLHPFGLPQTHSPARAVP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSMPEPYT
ASVVRSRNLLIYEEQSPLEEPSGPASAGELGHWDRGSSLLRASGLEPRPDVDLPHFIISN
ESSLEKSVLLELQQRLVSAKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagggcgccctgcagtgggaccgcaagctgagcgag
ctgtcggagcccggcgaccccgaggctctcctgtaccacacgcacttctcggaacttctg
gatgagttttcccagaacgtcttgggccagctcctgaatgaccctttcctctcagagaag
actgtgtcgatggaggtggagccgtccccaacgtccccggcgcctctcatccaggccgag
catagctactctctgtgcgaggagccgcgggcccagtcaccattcacccacgtcacctcc
agcgacagcttcaatgacgatgaagcggagagtgagaaatggtacctgtctgcggacttt
ccttcaaccaccatcaagaccgagcctattacggaggagtcacccccaggactcgtcccc
tctgtcactctgaccatcacagccatctccaccccgtttgaaaaggaggaacctcctctg
gaaatggatactggggttgattcctcgtgccagacagtcatccccaagattaagctggag
cctcatgaagtggatcggttcctcaacttctctcccaaagaagcctccgtggaccacctg
cacctcccgcccacccctcccagcagccacagcagtgactcggagggcagcctgagcccc
aacccgcgcctgcacccctttggcctgcctcagacccacagcccagccagggccgtgcca
cgggccccctccgccctctccagctccccgctcctcacagctccgcataaactgcagggc
tcaggccccctggtcctgaccgaggaggagaagaggacactgatcgccgagggctatccc
atccccaccaaactgcctctgacaaaatcagaggagaaggccctgaagaaaatccggagg
aaaatcaagaacaagatttctgcgcaggagagcaggagaaagaagaaagaatacatggac
agcttggagaaaaaggtggagtcttgttccaccgagaacttggagcttcggaagaaggtc
gaggtcctggagaacaccaacaggactctcctccagcagctgcagaagctgcagactttg
gtgatgggcaaggtttctcgcacctgcaagttggccggcacgcagactggcacctgcctg
atggtggttgtgttgtgctttgccgtggccttcggcagcttcttccagggctacgggccc
tatccttccgccaccaagatggccctgcccagccagcattccatgccggagccgtacaca
gcctccgtggtgagatccaggaacctgctgatctacgaggaacaatctcccctggaggag
ccgtctggccccgcctcggccggggagctgggccactgggacagaggctcctccctgctc
agggcgtcggggctggagcccaggcctgatgtggatcttccccatttcatcatctcgaac
gagagcagcctggagaagtcagtgctgttggagctgcagcagcgcctggtcagcgccaag
ctggaggggaatgaaaccctgaaggtcgtggaactcgacagaagagtgaacgccaccttc
tga

KEGG   Miniopterus natalensis: 107544933
Entry
107544933         CDS       T05883                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04668  TNF signaling pathway
mna04714  Thermogenesis
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04931  Insulin resistance
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04962  Vasopressin-regulated water reabsorption
mna05016  Huntington disease
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107544933 (CREB3)
   04024 cAMP signaling pathway
    107544933 (CREB3)
   04022 cGMP-PKG signaling pathway
    107544933 (CREB3)
   04151 PI3K-Akt signaling pathway
    107544933 (CREB3)
   04152 AMPK signaling pathway
    107544933 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107544933 (CREB3)
   04922 Glucagon signaling pathway
    107544933 (CREB3)
   04915 Estrogen signaling pathway
    107544933 (CREB3)
   04926 Relaxin signaling pathway
    107544933 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    107544933 (CREB3)
   04918 Thyroid hormone synthesis
    107544933 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    107544933 (CREB3)
   04916 Melanogenesis
    107544933 (CREB3)
   04925 Aldosterone synthesis and secretion
    107544933 (CREB3)
   04927 Cortisol synthesis and secretion
    107544933 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107544933 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107544933 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    107544933 (CREB3)
   04728 Dopaminergic synapse
    107544933 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    107544933 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    107544933 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107544933 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    107544933 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107544933 (CREB3)
   05020 Prion disease
    107544933 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    107544933 (CREB3)
   05031 Amphetamine addiction
    107544933 (CREB3)
   05034 Alcoholism
    107544933 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107544933 (CREB3)
   04934 Cushing syndrome
    107544933 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544933 (CREB3)
   05161 Hepatitis B
    107544933 (CREB3)
   05163 Human cytomegalovirus infection
    107544933 (CREB3)
   05165 Human papillomavirus infection
    107544933 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107544933 (CREB3)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107544933 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ABC_membrane_3 ADIP ZapB
Other DBs
NCBI-GeneID: 107544933
NCBI-ProteinID: XP_016078371
LinkDB
Position
Unknown
AA seq 361 aa
MELALDPGEQDLLGFLLEERGDLGAVPDEVFEAPLDWELPLSEALSDWDVEDFLSSLPSP
PASLNIFSNSDPRFVHHDHTYSLSQEHVSIDLDSGNCGNEGAQMTPLHVEDPAEQETVGL
ILTDEEKRLLEQEGLTLPGTGPLTKLEEQVLKRVRRKIRNKKSAQESRRKKKVYVGGLES
RVLKYTAQNLELQNKVQLLEEQNMSLLDQLRRLQAMVIQISNKTSSSSTCVLVLLFCFCL
IFVPAMYSSDTRGSLPAEHRVLSRQLRALPHQLQLSVLQSEVPEDSSDHELQAPGNSCCL
PSHLPQAPGTEPPLKLLLPDSFSKFPCPGPILPLHANLTREGEWLPAPSPISVILQGRYS
G
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggagctggcgttggacccgggtgaacaggacctactgggctttctgctagaggaaagg
ggagatttgggggcggtgcccgacgaggtcttcgaggctccactggactgggagttgccg
ctttctgaggcactaagcgattgggacgtagaggatttcctgagctccctgccgagtccc
ccagcatcgttgaacattttcagcaactctgatccccgttttgtccaccatgatcacacc
tactctctctcacaagaacatgtttccatagatctagatagtgggaactgtggaaacgag
ggggcccagatgactccactgcatgtggaggaccctgcagagcaggagactgttgggctg
atattgacagatgaggaaaagaggctattggagcaggaggggcttactctgcctggaaca
ggtcctctcactaagctagaggaacaagttctgaaacgagtgcggaggaagattcgaaat
aaaaagtctgctcaagagagccgcaggaagaagaaggtgtatgtggggggtttagagagc
agggtcttgaaatacacagcccagaatctggaactacagaacaaagtacagctcctggag
gaacagaatatgtccctcctggatcagttgaggagactccaggccatggtgattcagata
tcaaacaaaaccagcagcagcagcacttgtgtcttggtcctactgttttgcttctgtctc
atctttgtacctgctatgtactcctctgacacaagggggagcctgccagctgagcataga
gtattatcccgccagcttcgtgccctccctcatcagctgcagctgtctgtcctacagtcg
gaggtaccagaggatagctcagatcatgaactccaggctcctggcaactcttgctgcctg
ccctcgcacctgcctcaggctcctggcacagagcctcccctgaagttactactccctgat
tccttctcaaagttcccctgcccaggtcccatccttcccctgcatgcaaatctcacaaga
gagggggaatggcttcctgcccccagccccatatctgttatcttgcagggcagatactca
ggctag

DBGET integrated database retrieval system