KEGG   Miniopterus natalensis: 107524716
Entry
107524716         CDS       T05883                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107524716 (FZD5)
   04390 Hippo signaling pathway
    107524716 (FZD5)
   04150 mTOR signaling pathway
    107524716 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107524716 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107524716 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524716 (FZD5)
   05205 Proteoglycans in cancer
    107524716 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107524716 (FZD5)
   05226 Gastric cancer
    107524716 (FZD5)
   05217 Basal cell carcinoma
    107524716 (FZD5)
   05224 Breast cancer
    107524716 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107524716 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    107524716 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107524716 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107524716 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107524716 (FZD5)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107524716 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107524716
NCBI-ProteinID: XP_016052202
LinkDB
Position
Unknown
AA seq 586 aa
MARPDPSAPPSLLLLLLAQLAGRAVAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLLFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTVPPRIFPVKPTLPGPPGALPSGG
ECAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVMGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSSKTVESWRRFTSRCCCR
RRRGHKSGGATAARDYGEASAALTGRTGPPGPAAAAYHKQVSLSHV
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccttctgcgccgccctcgctgctgctgctgctcctggcgcagctg
gcaggccgagcggtggccgcctccaaggccccggtgtgccaggaaatcacggtacccatg
tgccgcggcataggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccaattctggccgctggtggagatccactgctctccg
gacctgctcttcttcctgtgctccatgtacacgcccatctgcctgccggactatcacaag
cccctgccgccctgccgctcggtgtgcgagcgcgccaaagccggctgctcgcccctcatg
cgccagtatggcttcgcctggccggagcgcatgagctgcgaccgcctcccggtgctgggg
cgcgacgccgaggtcctgtgcatggattacaatcgtagtgaggccaccacggtgccccct
aggatcttcccggtcaaacccactctcccaggcccaccaggagctctgccctcgggaggg
gagtgcgccgctgggggcccgtcggtgtgcaagtgccgagaacctttcgtgcccattctg
aaggagtcgcacccgctctacaacaaggtgcggacaggccaggtacccaattgcgcggtg
ccctgctaccagccctccttcagccccgacgagcgcacgttcgccaccttctggatcggc
ctgtggtccgtgctgtgctttatctccacctccaccactgtggccaccttcctgatagac
atggagcgcttccgttacccggagcgccccatcatctttctgtcagcttgctacttgtgc
gtgtctctgggcttccttgtgcgcctggtcatgggccatgccagtgtcgcctgcagccgt
gagcacagccacattcactacgagacgacgggccctgcgctctgcactgtcgtcttcctg
ctggtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcagccggtatgaagtggggcaatgaggccatcgcaggctatgcacagtacttc
cacctggccgcatggctcatccccagcgtcaagtccatcactgcgctggcactgagctcc
gtggacggggatccagtggctggcatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggccctctggtgctctacctgctggtgggcacgctcttcctcttg
gcgggcttcgtgtcgctcttccgcatccgtagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcattggcatcttcacgctgctctacacggtgccc
gccagcatcgtggtggcctgctacctgtacgagcagcactatcgcgagagctgggaggct
gcgctcacctgcgcgtgcccgggcccggacacgggccagccgcgcgccaagccggagtac
tgggtcctcatgctcaagtacttcatgtgcctcgtggtgggcatcacctccggcgtctgg
atttggtccagcaagactgtggagtcctggcggcgattcaccagccgctgctgctgccgc
cggcgacggggccacaagagtggaggcgccactgctgcccgggactatggcgaggcgagc
gcagcgctcacgggcaggacagggccaccgggccccgccgcagccgcctaccacaagcaa
gtgtccctgtcgcacgtgtag

KEGG   Miniopterus natalensis: 107525076
Entry
107525076         CDS       T05883                                 

Gene name
FZD8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107525076 (FZD8)
   04390 Hippo signaling pathway
    107525076 (FZD8)
   04150 mTOR signaling pathway
    107525076 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107525076 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107525076 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525076 (FZD8)
   05205 Proteoglycans in cancer
    107525076 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107525076 (FZD8)
   05226 Gastric cancer
    107525076 (FZD8)
   05217 Basal cell carcinoma
    107525076 (FZD8)
   05224 Breast cancer
    107525076 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107525076 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    107525076 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107525076 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107525076 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107525076 (FZD8)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107525076 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107525076
NCBI-ProteinID: XP_016052645
LinkDB
Position
Unknown
AA seq 442 aa
MEWCYLLEVTSLLAALALLQLSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDMLCMDYNRTDLSGEYQELGAVEQHVRYETTGPALC
TVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAV
LALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQ
QGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPD
QARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKAGSLYSDVSTG
LTWRSGTASSVSYPKQMPLSQV
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggagtggtgttacctgttggaagtgacctccttgctggccgccttggcgctgctgcag
ctctccagcggcgctgcggctgcctcagccaaggagctggcgtgccaagagatcaccgtg
ccgctgtgcaagggtatcggctacaactatacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccagttctggcccctggtggaaatccagtgt
tcgccagacctcaagttcttcctgtgcagcatgtacacgcccatctgcctagaggactac
aagaagcccctgcctccctgccgctccgtgtgcgagcgcgccaaggccggatgcgcaccc
ctcatgcgccagtacggctttgcctggccggaccgcatgcgctgcgaccggctgccggaa
cagggaaacccagacatgctgtgcatggactacaaccgcacggacctcagcggcgagtac
caggagctgggcgctgtggagcagcatgtgcgctatgagacaacaggcccggcgctgtgc
accgtggtcttcctgctcgtctacttcttcggcatggccagctctatctggtgggtgatt
ctgtcgctcacgtggtttctggcggcgggcatgaaatggggcaacgaggccatcgctggc
tactcgcagtacttccacctggccgcgtggctcgtgcccagcgttaagtccatcgccgtg
ctggcgctcagctccgtggacggcgacccagtggcgggcatctgctacgtgggcaaccag
agcctcgacaacctgcgcggcttcgtgctggcgccgctcgtcatctatcttttcattggc
accatgttcttgctggccggcttcgtgtccctcttccgcatccgctcagtcataaaacag
cagggcggccccaccaagactcacaagctggagaagctcatgatccgcctgggactcttc
accgtcctctacacggtgcccgccgccgtcgtggtcgcctgcctcttctacgagcagcac
aaccgcccgcgctgggaggccacgcacaactgcccttgcctgcgcgacctgcagcccgac
caggcgcgccgacccgactacgctgtcttcatgctcaagtacttcatgtgcctggtcgtc
ggcatcacctcgggggtgtgggtctggtcaggcaagacgctcgagtcgtggcgggccttg
tgcacccgctgctgctgggccagcaaggctggctcgctctacagtgacgtcagcacaggc
ctgacttggcgatctggcaccgccagctccgtgtcttaccccaagcagatgccattgtcc
caagtctga

KEGG   Miniopterus natalensis: 107526557
Entry
107526557         CDS       T05883                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107526557 (FZD9)
   04390 Hippo signaling pathway
    107526557 (FZD9)
   04150 mTOR signaling pathway
    107526557 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107526557 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107526557 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107526557 (FZD9)
   05205 Proteoglycans in cancer
    107526557 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107526557 (FZD9)
   05226 Gastric cancer
    107526557 (FZD9)
   05217 Basal cell carcinoma
    107526557 (FZD9)
   05224 Breast cancer
    107526557 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107526557 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    107526557 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107526557 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107526557 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107526557 (FZD9)
   04090 CD molecules [BR:mna04090]
    107526557 (FZD9)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107526557 (FZD9)
CD molecules [BR:mna04090]
 Proteins
  107526557 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 107526557
NCBI-ProteinID: XP_016054541
LinkDB
Position
Unknown
AA seq 553 aa
CQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAP
MCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPEN
ATAGPAEPHKGLGMLPVAPRPARPPGDAAPGLGAGGTCENPEKFQYVEKSRSCAPRCGPG
VEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYS
LAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTW
FLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASMDAAAL
TGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVP
ATCVIVCYVYERLNMDFWRLRATEQLCSPASVQGGRRDCSLQGGSVPTVAVFMLKIFMSL
VVGITSGVWVWSSKTFQTWQSLCHRKMAAGRARAKACRAPGAYGRGTHCHYKAPTVVLHM
TKTDPSLENPTHL
NT seq 1662 nt   +upstreamnt  +downstreamnt
tgccaggcggtggaaatccccatgtgccgcggcatcggctataacctgacccgtatgccc
aacctgctgggccacacgtcgcagggggaggcagccgcggagctggccgagtttgcgcct
ctcgtgcaatacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcgccc
atgtgcaccgaccaggtctcgacgcccatccccgcctgccggcccatgtgcgagcaggcg
cggctgcgctgcgcgcccatcatggaacagttcaacttcggctggccggactcgctggac
tgcgccaggctgcccacgcgcaacgacccccacgcgctctgcatggaggcccccgagaac
gccacggcaggccccgctgaaccccataagggcctgggcatgctgcctgtggcgccgcgg
cccgcgcggcccccgggagacgcagccccgggcctgggcgccgggggcacctgcgagaac
cccgaaaagttccagtacgtagagaagagccgctcctgcgcgccgcgctgcgggccgggt
gtcgaggtgttctggtcgcggcgtgacaaggacttcgcgctcgtctggatggccgtgtgg
tcagcgctgtgcttcttctccacggccttcaccgtactcaccttcctgctggagcctcac
cgcttccagtaccctgagcgccccatcatcttcctctccatgtgctacaacgtctactcg
ctggccttcctcatccgcgcggtggccggggcccagagcgtggcctgcgaccaggaggcc
ggcgcgctctacgtgatccaggagggcctggagaacacgggctgtaccctcgtcttcttg
ctgctctactacttcggcatggccagctcgctgtggtgggttgtgctcacactcacttgg
ttcctggcagccggcaagaaatggggccacgaggccattgaggcccacggcagctacttc
cacatggcggcctggggcctgccggccctaaagaccatcgtcatcctgacgctgcgcaag
gtggctggggatgagctgactgggctctgctatgtggccagcatggatgcagctgcgctc
acaggcttcgtgctggtgcccctgtcctgctacttggtgctgggcaccagcttcctcctg
actggcttcgtggcccttttccacatccgcaagatcatgaagacaggaggcaccaacaca
gaaaagctagagaagctcatggtcaagatcggggtcttctccatcctgtacacagtgcct
gccacctgcgtcattgtgtgctacgtctatgaacgcctcaacatggacttctggcgcctt
cgggctacagagcaactgtgttccccagccagcgtacagggtggccggagggactgctcg
ctgcaagggggctcagtgcccactgtggctgtctttatgctcaaaatcttcatgtcactg
gtggtgggcataaccagcggtgtctgggtatggagctccaagactttccagacctggcag
agcctatgccaccgcaagatggcagctggccgagcccgggcaaaggcctgccgagcccca
ggggcctatggccgtggcacccactgccactataaggcccccaccgtggtcttgcacatg
actaagacggacccctctctggagaaccccacacacctctag

KEGG   Miniopterus natalensis: 107528834
Entry
107528834         CDS       T05883                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107528834 (FZD2)
   04390 Hippo signaling pathway
    107528834 (FZD2)
   04150 mTOR signaling pathway
    107528834 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107528834 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107528834 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528834 (FZD2)
   05205 Proteoglycans in cancer
    107528834 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107528834 (FZD2)
   05226 Gastric cancer
    107528834 (FZD2)
   05217 Basal cell carcinoma
    107528834 (FZD2)
   05224 Breast cancer
    107528834 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528834 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    107528834 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107528834 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107528834 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107528834 (FZD2)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107528834 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107528834
NCBI-ProteinID: XP_016057489
LinkDB
Position
Unknown
AA seq 600 aa
MERLRCFGLEEGTKESLGGEGRGEARGGGRRGERAGSARXRSALPRLLLPLLLLPAAGPA
QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQ
CSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPR
HGAEQICVGQNHSEDGAPALLTTAPPPGLQPGXGGTPGGPGGGGSPPRYATLEHPFHCPR
VLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTV
TTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTK
KEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVK
TITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRT
IMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLA
IPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGET
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggagaggctgcggtgcttcgggctggaggaaggcacaaaggagtcgctgggcggagaa
gggaggggagaggctagagggggaggaagaagaggagagagagcaggcagcgcgcggtnc
cgcagcgccctgccccgcctgctgctgccgttactgctgctgcccgccgcggggccggcc
cagttccacggagagaagggcatctccatcccggaccacggcttctgccagcccatctcc
atcccgctgtgcacggacatcgcctacaatcagaccatcatgcccaaccttctgggccat
acgaaccaggaggacgcgggcctggaggtgcaccagttctacccgttggtgaaagtgcag
tgctcgcccgaactgcgcttcttcttgtgctccatgtacgcacccgtgtgtaccgtgctg
gagcaggccataccgccgtgccgctccatttgcgagcgcgcacgtcagggctgcgaggcg
ctcatgaacaagttcggcttccagtggcccgagcgcctgcgctgcgagcacttcccgcgc
cacggtgcggagcagatctgcgtgggccagaaccactctgaggacggcgcgcccgcactg
ctcaccacggcgccgccgcccggcctgcagcccggnnntggaggcaccccaggcggcccg
ggcggcggcggctcgcccccgcgctacgccacgctggagcacccgtttcactgcccgcgc
gtcctcaaggtgccgtcctacctcagctacaagttcctgggcgagcgcgactgcgcggcg
ccctgcgagccggcgcggccggacggctccatgttcttctcgcaggaggagacgcgtttt
gcgcgcctctggattctcacctggtcggtgctgtgctgcgcctccactttcttcaccgtc
actacgtacctggtggacatgcagcgcttccgctaccccgagcggcccatcatcttcttg
tccggctgctacacgatggtgtcggtggcctatatcgcgggtttcgtgctccaggagcgc
gtggtgtgcaacgagcgcttctccgaggacggttaccgcacggtggtgcagggcaccaag
aaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggccagttccatc
tggtgggtcatcctgtcgctcacctggttcctggcggcgggcatgaagtggggccacgag
gccatcgaggccaactcgcagtacttccacctggccgcgtgggccgtgccggcggtcaag
acaatcactatcctggccatgggccagattgacggcgacctgctgagcggcgtgtgcttc
gtgggcctcaatagcctggacccgctgcggggcttcgtgctggcgccgctcttcgtgtac
ctgttcatcggcacgtccttcctcctggccggtttcgtgtcgctcttccgcatccgcacc
atcatgaagcacgacggcaccaagacggagaagctggagcggctcatggtgcgcatcggc
gtcttctccgtgctctacacggtgcccgccaccatcgtcatcgcctgctacttctacgag
caggccttccgcgagcactgggagcgctcgtgggtgagccagcactgcaagagcctggcc
atcccgtgccccgcgcactacacgccgcgcatgtcgcccgacttcaccgtctacatgatc
aaatacctcatgacgctcatcgtgggcatcacctcgggcttctggatctggtccggcaag
acgctgcactcgtggaggaagttctacacgcgcctcaccaacagccggcacggcgagacc

KEGG   Miniopterus natalensis: 107529641
Entry
107529641         CDS       T05883                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107529641 (FZD10)
   04390 Hippo signaling pathway
    107529641 (FZD10)
   04150 mTOR signaling pathway
    107529641 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107529641 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107529641 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529641 (FZD10)
   05205 Proteoglycans in cancer
    107529641 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107529641 (FZD10)
   05226 Gastric cancer
    107529641 (FZD10)
   05217 Basal cell carcinoma
    107529641 (FZD10)
   05224 Breast cancer
    107529641 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107529641 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    107529641 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107529641 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107529641 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107529641 (FZD10)
   04090 CD molecules [BR:mna04090]
    107529641 (FZD10)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107529641 (FZD10)
CD molecules [BR:mna04090]
 Proteins
  107529641 (FZD10)
SSDB
Motif
Pfam: Frizzled
Other DBs
NCBI-GeneID: 107529641
NCBI-ProteinID: XP_016058609
LinkDB
Position
Unknown
AA seq 400 aa
MQDGGAGRAGCANPGKFHRVERSASCAPLCTPGVDVYWSRDDKRFAVVWLAVWSVLCFVS
SAFTVLTFLIDPDRFRYPERPIIFLSMCYCVSSLGYIVRLFAGAESIACDRDSGQLYVIQ
EGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAI
PAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVLGTSFILSGFVALF
HIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNVEYWKALAAQRKC
RVDHQTKSLDCLMAASIPAVEVSLLKIFMLLVVGITSGVWIWTAKTLQSWRGVCSRRFAK
RGARKAAGGIAHGGIYKKAQHPPKTYLGKCEIPAQPPTCV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgcaggacggcggcgcggggcgcgcgggctgcgccaacccgggcaagttccaccgcgtg
gagaggagcgcgtcgtgcgcgccgctctgcacgcccggcgtggacgtgtactggagccgc
gacgacaagcgcttcgccgtggtctggctggcggtgtggtccgtcctgtgcttcgtctcc
agcgccttcacggtgctcaccttcctcatcgaccccgaccgcttccgctaccccgagcgc
cccattatcttcctgtccatgtgctactgcgtgtcctcgctgggctacatcgtgcgcctg
ttcgcgggcgccgagagcatcgcctgcgaccgcgacagcgggcagctctatgtcatccag
gagggcctggagagcaccggctgcacgctcgtgttcctggtgctctactacttcggcatg
gccagctcgctctggtgggtgatcctcacgctcacctggttcctggccgcgggcaagaag
tggggccacgaggccatcgaggccaacagcagctacttccacctggcggcctgggccatc
cccgccgtgaagaccatcctcatcctggtgatgcgccgcgtggcgggcgacgagctcacg
ggcgtctgctacgtgggcagcatggacgtgaacgcgctcacgggcttcgtgctggtgccg
ctggcctgttacctcgtcctgggcacgtccttcatcctctcgggcttcgtggcgcttttc
cacatccgccgggtgatgaagacgggcggcgagaacacggacaagctggagaagctcatg
gtgaggatcggcgtgttctccgtgctgtacacggtgccggccacctgcgtgatcgcctgt
tacttctacgagcgcctcaacgtggagtactggaaggcgctggcggcgcagcgcaagtgc
cgcgtggaccaccagaccaagagcctggactgcctcatggccgcgtccatccccgccgtg
gaggtctcgctgctgaagatcttcatgctgctggtcgtgggcatcaccagcggcgtgtgg
atctggacggccaagacgctgcagtcctggcgcggcgtctgcagccgccggttcgccaag
aggggcgcgcgcaaggcggccggcggcatcgcgcacggcgggatttacaaaaaggcgcag
caccccccaaagacgtacctggggaagtgcgaaatccccgcgcagcctcccacctgcgtg
tga

KEGG   Miniopterus natalensis: 107532452
Entry
107532452         CDS       T05883                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4 isoform X1
  KO
K02354  frizzled 4
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107532452 (FZD4)
   04390 Hippo signaling pathway
    107532452 (FZD4)
   04150 mTOR signaling pathway
    107532452 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107532452 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107532452 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532452 (FZD4)
   05205 Proteoglycans in cancer
    107532452 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107532452 (FZD4)
   05226 Gastric cancer
    107532452 (FZD4)
   05217 Basal cell carcinoma
    107532452 (FZD4)
   05224 Breast cancer
    107532452 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107532452 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    107532452 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107532452 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107532452 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107532452 (FZD4)
   04090 CD molecules [BR:mna04090]
    107532452 (FZD4)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107532452 (FZD4)
CD molecules [BR:mna04090]
 Proteins
  107532452 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 107532452
NCBI-ProteinID: XP_016062304
LinkDB
Position
Unknown
AA seq 536 aa
MAWRGAGPSVLGASGGVGLRLWLLLVLLLPGPAWGFGDEEERRCDPIRISMCQNLGYNVT
KMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMC
LSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEC
HSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTF
LIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTG
CAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIV
ILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQ
KDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWAIFRYSADDSNMAVEMLKI
FMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgagcgtcctgggggcgtccgggggcgtcggtctccgt
ctgtggctgctgctggtgctgctgctcccggggccggcttggggcttcggggacgaggag
gagcggcgctgcgaccccatccgcatctccatgtgccagaacctgggctacaacgtgacc
aagatgcccaaccttgtggggcatgagctgcagaccgacgccgagctgcagctgaccact
ttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttccgtg
tatgtgccaatgtgcacagagaagatcaacatccccatcggcccatgtggcggcatgtgt
ctgtctgtcaagagacgctgtgaacctgtcctgaaggaatttggatttgcctggccggag
agcctaaactgcagcaaatttccaccccagaatgaccacaaccacatgtgcatggaaggg
ccaggagatgaggaggtgcccttacctcacaaaacccccatccagcctggggaagagtgc
cattccgtgggaaccaactccgatcagtacatctgggtgaaaaggagcctgaactgcgtt
ctcaagtgtggctacgatgctggcttgtacagccgctcggccaaggagttcacggatatc
tggatggccgtgtgggccagcctgtgcttcatctctaccgccttcaccgtgctcaccttc
ctgatcgattcttccaggttttcctaccctgagcgccccatcatatttctcagtatgtgc
tataatatttatagcattgcttatattgtcaggctgactgtaggccgggagaggatatcc
tgcgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacacagga
tgtgcaatcattttcttgctgatgtacttttttggaatggccagttccatctggtgggtt
attctgacactcacttggtttttggcagctggactcaaatggggtcatgaagccattgaa
atgcacagctcttatttccacattgcggcctgggccatccctgcagtgaaaactattgtt
atcttgattatgagactggtggacgcagatgaactcactggcctatgctacgttgggaac
caaaaccttgatgccctcacaggttttgtggtggctcccctgttcacctacctggtgatt
ggaactttgttcattgctgcaggtttggtggccttgttcaaaattcggtcaaatctgcaa
aaggatgggacaaagacagacaagttggaaaggctgatggtcaagattggggtcttctca
gtcctgtacacggttcctgcaacctgtgtgattgcctgttatttctatgaaatctccaac
tgggcgattttccggtattctgcagatgactccaatatggcagttgaaatgttgaaaatt
tttatgtctttgctggtgggcatcacttcaggcatgtggatttggtctgccaaaactctt
cacacgtggcagaagtgttccaacagattggtgaattctgggaaggtaaagagagaaaaa
agagggaatggttgggtaaagcctgggaaaggcaatgaaactgtggtataa

KEGG   Miniopterus natalensis: 107533927
Entry
107533927         CDS       T05883                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107533927 (FZD7)
   04390 Hippo signaling pathway
    107533927 (FZD7)
   04150 mTOR signaling pathway
    107533927 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107533927 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107533927 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533927 (FZD7)
   05205 Proteoglycans in cancer
    107533927 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107533927 (FZD7)
   05226 Gastric cancer
    107533927 (FZD7)
   05217 Basal cell carcinoma
    107533927 (FZD7)
   05224 Breast cancer
    107533927 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107533927 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    107533927 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107533927 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107533927 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107533927 (FZD7)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107533927 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 107533927
NCBI-ProteinID: XP_016064295
LinkDB
Position
Unknown
AA seq 640 aa
MRGPRADTPRSRVGLCTLMLVLLGALPAGAGAQPYHGEKGISVPDHGFCQLISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDKAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTPYP
TAPYMPDLPFTALPPGAADGRGRSAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETDLESAKTDVDVGRGVGLERRPEWEDGLD
ADTLADLQGNDDDSNRDDVCRVRCGPTWVYGEDRAPQRVL
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgcggggcccccgcgcagatacgccgcgctctcgggtgggcctatgcaccctgatgctt
gtgctcctgggcgcgctgcccgcgggcgccggggcgcagccgtaccacggtgaaaagggt
atctcggtgccggaccacggcttctgccagctcatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggccacaccaaccaagaggatgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctccggagctgcgcttc
ttcctgtgctccatgtacgcacccgtgtgcaccgtgctggataaggccatcccgccgtgc
cgctctctgtgcgagcgtgcccgccagggctgcgaagcgctcatgaacaagttcggcttc
cagtggccggagcggctgcgctgcgagaacttcccggtgcacggcgccggcgagatctgc
gtgggccagaacacgtccgacggctccgggggtccgggcggcggtcccaccccctacccc
accgcgccctacatgcccgacttgcccttcactgcgctgcccccgggggccgctgacggc
aggggccgttccgcctttcccttctcgtgcccccgccagctcaaggtgcccccctacctg
ggctaccgcttcctgggcgagcgcgactgcggcgccccgtgcgagcctggccgcgccaac
ggcctcatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtatgg
tcggtgctttgctgcgcctccacgctcttcacggtcctcacctacctagtggacatgcgg
cgcttcagctaccccgagcggcccatcatcttcctgtcgggctgctacttcatggtggct
gtggcgcacgtggccggcttcctgctagaggaccgcgccgtgtgcgtggagcgcttctca
gacgacggctaccgcacggtggcgcagggcaccaagaaggaggggtgcaccatcctcttc
atggtcctctacttcttcggcatggccagttccatctggtgggtcatcctgtcgctcacg
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggccaactcgcagtac
ttccacctggccgcgtgggcggtgcccgcggtcaagaccatcaccatcctggccatgggc
caggtggacggggacctgctcagcggggtgtgctacgtgggcctgtccagcgtggacgcg
ctgcggggcttcgtgctggcgcccctgttcgtctacctcttcatcggcacgtccttcctg
ctggcaggcttcgtgtcgctcttccgcatccgcacgatcatgaagcacgacggcaccaag
accgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacacggtg
ccggccaccatcgtcctggcctgttacttctacgagcaggccttccgcgagcactgggag
cgcacctggctcctgcagacctgcaagagctatgcggtgccctgcccccccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtg
ggcatcaccaccggcttctggatctggtccgggaagaccctacagtcgtggcgccgcttc
taccacagactcagccacagcagcaagggggagactgacctggaaagcgcgaagactgat
gtagacgtgggacgaggggtgggtttggaaaggaggcccgagtgggaagacggtttggac
gcagacactctggccgacttgcagggtaatgacgatgattctaatcgcgatgatgtttgt
cgtgtaaggtgcggaccgacgtgggtctacggagaagaccgagccccgcagcgagtgctg
tga

KEGG   Miniopterus natalensis: 107537768
Entry
107537768         CDS       T05883                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3 isoform X1
  KO
K02329  frizzled 3
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107537768 (FZD3)
   04390 Hippo signaling pathway
    107537768 (FZD3)
   04150 mTOR signaling pathway
    107537768 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107537768 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107537768 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    107537768 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537768 (FZD3)
   05206 MicroRNAs in cancer
    107537768 (FZD3)
   05205 Proteoglycans in cancer
    107537768 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107537768 (FZD3)
   05226 Gastric cancer
    107537768 (FZD3)
   05217 Basal cell carcinoma
    107537768 (FZD3)
   05224 Breast cancer
    107537768 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107537768 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    107537768 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107537768 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107537768 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107537768 (FZD3)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107537768 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107537768
NCBI-ProteinID: XP_016069343
LinkDB
Position
Unknown
AA seq 666 aa
MAMSWIVFYLWPFTMFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggatcgtcttctatctttggccgttcactatgtttgtgggacatata
ggtgggcacagtttgttttcttgtgaacctattaccttgagaatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccagcagacagcagcttta
gcaatggagccattccaccctatggtgaatctggattgttctcgggatttccggccattt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagcgagtgttcaaagcttatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgaaccataccctcgactt
gtggatctgaatttagctggagatcctactgaaggagccccagtggcagtgcagagggac
tatggtttttggtgtccccgggagttgaaaattgatcctgatcttggttattcttttttg
cacgtgcgtgattgttcacctccctgtccaaatatgtacttcaggagagaagaactttca
tttgctcgatatttcataggattgatttcaatcatttgcctctctgccacgttgtttacc
tttttaacttttttgattgatgtcacaagattccgttatcctgaaagacctattatattt
tatgcagtctgctacatgatggtatcattaattttcttcattgggtttttgcttgaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactttatttttttactatggctggc
agcgtttggtgggtaattcttaccatcacatggttcttggcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctatttcacgccagtgcatggggcatccctgga
actctgactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgcacccctctgc
ctatatgtggtagttggggtttcactgcttttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattggtgaagtttatgatccgg
attggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacttggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggtcactcagatgagtcgtccagacctgattctcttt
ctgatgaaatacctgatggctctcatagttggtattccctccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagcagacaggtactccaagaacctgattttgctcagtccctcctgagggatcca
aatactcctattataagaaaatcaagaggaacgtccactcaaggaacatccacacatgct
tcttccactcagctggctatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccacggcagcctccacagatcccgtgatggcaggtacactccctgc
agttacagaggaatggaagagagactacctcatggcagcatgtcacgactaacggaccac
tccaggcacagtagttctcatcggctcaatgaacagtcacgacatagcagcatccgagat
ctcagtaataatcctatgactcacatcacacatggcaccagcatgaaccgagttattgaa
gaagatggaaccagtgcttaa

KEGG   Miniopterus natalensis: 107541653
Entry
107541653         CDS       T05883                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107541653 (FZD1)
   04390 Hippo signaling pathway
    107541653 (FZD1)
   04150 mTOR signaling pathway
    107541653 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107541653 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107541653 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541653 (FZD1)
   05205 Proteoglycans in cancer
    107541653 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107541653 (FZD1)
   05226 Gastric cancer
    107541653 (FZD1)
   05217 Basal cell carcinoma
    107541653 (FZD1)
   05224 Breast cancer
    107541653 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541653 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    107541653 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107541653 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107541653 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107541653 (FZD1)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107541653 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 107541653
NCBI-ProteinID: XP_016074263
LinkDB
Position
Unknown
AA seq 597 aa
GRLARWLLLLLWLLEAPLLLGVRAQAAGQGPGPGQQPPPPPPPQQQSGQQYNGERGISIP
DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCS
MYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQN
TSDKGTPTPSLLPEFWTSNPQHSGGGHRGGGFPGGAGASERGKFSCPRALKVPSYLNYHF
LGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSY
PERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFSEDGARTVAQGTKKEGCTILFMMLY
FFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDG
DVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKL
EKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGA
PPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1794 nt   +upstreamnt  +downstreamnt
gggcgcttggcgcgctggctactgctgctgctttggctgttggaggctccgctgctgctt
ggggtccgggcgcaggcggcgggccaggggcctgggccgggtcagcagcccccgccgcca
ccgcctccgcagcaacagagcgggcagcagtacaacggcgagcggggcatctccatcccg
gaccacggctactgccagcccatctccatcccgctgtgcacggacatcgcgtacaaccag
accattatgcccaacctgctgggccacacgaaccaggaggacgcgggcctcgaggtgcac
cagttctacccgctggtgaaggtgcagtgctcggccgagctcaagttcttcttgtgctcc
atgtacgcgcccgtgtgcaccgtgctggagcaggctctgccgccctgccgctccctctgc
gagcgcgcgcgccagggctgcgaggcgctcatgaacaagttcggcttccagtggcccgac
acgctcaagtgcgagaagttcccggtgcacggcgcgggcgagctgtgcgtgggccagaac
acgtcggacaagggtaccccgacgccctctctgctgccggagttctggaccagcaacccc
cagcacagcggcggggggcaccgcggcggcggcttcccggggggtgccggcgcgtcggag
cggggcaagttctcgtgcccgcgcgccctcaaggtgccttcctacctcaactaccacttc
ctgggggagaaggactgcggcgcgccctgtgagcccaccaaggtgtacgggctcatgtac
ttcgggcccgaggagctgcgcttctcgcgcacctggatcggcatctggtcggtgctgtgc
tgcgcctccacgctcttcacggtgctcacgtacctggtggacatgcggcgcttcagctac
cccgagcggcccatcatcttcctgtcgggctgctacacggccgtggccgtggcctacatc
gccggcttcctgctggaggaccgggtggtgtgtaacgacaagttctccgaggacggggcg
cgcaccgtggcgcagggcaccaagaaagagggctgcaccatcctcttcatgatgctctac
ttcttcagcatggccagctccatctggtgggtgatcctgtcgctcacctggttcctggcg
gccggcatgaagtggggccacgaggccatcgaggccaactcgcagtatttccacctggcc
gcctgggccgtgccggccatcaagaccatcaccatcctggcgctgggccaggtggacggc
gacgtgctgagcggggtgtgcttcgtggggctcaacaacgtggacgcgctgcgcggcttc
gtgctggcgccgctcttcgtgtacctgttcatcggcacgtccttcctgctggccggcttc
gtgtcgctcttccgcatccgcaccatcatgaagcacgacggcaccaagacggagaagctg
gagaagctcatggtgcgcatcggcgtcttcagcgtgctctacacggtgcccgccaccatc
gtcatcgcctgctacttctacgagcaggccttccgggaccagtgggagcgcagctgggtg
gcccagagctgcaagagctacgccatcccctgcccccacctccaggcgggcggaggggcg
ccgccgcacccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgacg
ctgatcgtcggcatcacgtcgggcttctggatctggtccggcaagaccctgaactcctgg
aggaagttttacacgagactcaccaacagcaaacagggggagaccaccgtctga

KEGG   Miniopterus natalensis: 107546030
Entry
107546030         CDS       T05883                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6 isoform X1
  KO
K02376  frizzled 6
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107546030 (FZD6)
   04390 Hippo signaling pathway
    107546030 (FZD6)
   04150 mTOR signaling pathway
    107546030 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107546030 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107546030 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107546030 (FZD6)
   05205 Proteoglycans in cancer
    107546030 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107546030 (FZD6)
   05226 Gastric cancer
    107546030 (FZD6)
   05217 Basal cell carcinoma
    107546030 (FZD6)
   05224 Breast cancer
    107546030 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107546030 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    107546030 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107546030 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107546030 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107546030 (FZD6)
G protein-coupled receptors [BR:mna04030]
 Frizzled / Smoothened family
  107546030 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC
Other DBs
NCBI-GeneID: 107546030
NCBI-ProteinID: XP_016079770
LinkDB
Position
Unknown
AA seq 712 aa
MGMLALLWTCVFLPLARGHSLFTCEPVTVPRCMNMAYNMTYFPNLMGHYDQSTAAVKMEL
FHPLANLECSPNVETFLCKAFVPTCTEQIHVVPPCRRICEKVYSDCKKLIDTFGIQWPEE
LKCDRLQYCDETFPVTLDPQTEFLGPQKKTEQVQRDIGIWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNSTACNKADEKLGVGDTVVLGSQNKACTVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAVFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGTSANHSTSAVAITNHDYLGQETLTEIPTSPETTVREV
RGDGVSTPKSREQDCGEPASPAVSSSKLCGEQAHRQGRAGGATDRSSVSESARSEGRVTP
KSDATETGLVQSKNLEVPSPLEPSSPKDSTSLLVHLAAGVRKEQGSGSHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggggatgctggcgcttctgtggacgtgtgtttttctgcccctcgcgagagggcacagc
cttttcacgtgtgaaccggtcaccgttcccaggtgcatgaacatggcctacaacatgacc
tatttcccgaacctcatgggccactacgatcagagcacggcggctgtgaagatggagctc
tttcatcctcttgcaaatctggaatgttcaccaaatgttgaaactttcctttgcaaagct
tttgtaccaacctgcacagagcaaattcatgtggttccaccttgtcgtagaatttgtgag
aaagtatattctgattgcaaaaaattaattgacacttttgggatccaatggcctgaggaa
cttaaatgtgacagattacagtattgtgatgagacttttcctgtaactcttgatccacaa
acagagtttcttggtcctcagaagaaaacagaacaagtccaaagagacattggaatttgg
tgtccaaggcatcttaagacttctgggggacaagggtataagttcctgggaattgaccag
tgtgcacctccatgccccaacatgtactttaaaagcgatgagctagagtttgcaaaaagt
tttataggaatagtttcaatattttgtctctgtgcaactctgttcacatttcttactttt
ttaatcgatgttaaaagattcagatacccagagagaccaattatatattactctgtctgt
tacagcattgtatctctgatgtattttattggattcttgctaggcaatagcacagcctgc
aataaagcagatgagaagctaggcgttggtgatacagttgttctaggctcccaaaataag
gcctgcaccgttttgtttatgtttttgtattttttcacaatggccggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgcaggaagaaagtggagctgtgaagccatt
gaacagaaagcggtgtggtttcatgctgttgcgtggggaataccaggttttctgactgtt
atgcttcttgccatgaacaaagttgagggagacaacattagtggggtttgctttgtcggc
ctttatgacctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gtcgggctatctcttcttttagctggcatcatttccttaaatcacgttcgacaagtgata
cagcacgatggccgtaaccaagagaaactaaagaaatttatgattcgaattggagtcttc
agtggcctgtatcttgtgccattagtgacacttcttgggtgttacgtctatgagcaagtg
aacaggattacctgggagataacttgggtctctgaccattgtcgtcagtaccatatcccc
tgtccttatcaggcaaaagcagaaactcgaccagaattggccttatttatgataaaatat
ctgatgacgttaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgtgttttttaaacgtaatcgcaagagagatcccatcagtgaaagtcga
cgagtactacaggagtcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactacaagccgagttcacataagctgaaggtcatttccaaatccatgggaacc
agcacaggaacctcagcaaaccacagcacttctgcagtggccatcacgaaccacgattac
ttaggacaagaaactttgacagaaatcccaacctctccagaaacgaccgtgagggaagtg
agaggagacggagtgagcacccccaaatcaagagaacaggactgcggggagcctgcctcc
ccagcagtatccagctccaaactgtgcggggagcaggcccacaggcaaggccgggcgggc
ggcgccaccgataggagcagcgtatctgaaagtgcgcggagtgaggggagggtgactcca
aaaagtgatgctactgaaactggcctggtgcagagcaagaacttggaggttcccagccct
ttagagccaagcagcccgaaagactccacatcactgctcgttcacttggctgcgggagtt
aggaaagagcagggctctggcagccactcagatacttga

DBGET integrated database retrieval system