KEGG   Miniopterus natalensis: 107524724
Entry
107524724         CDS       T05883                                 

Gene name
GABARAPL2
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
mna  Miniopterus natalensis
Pathway
mna04068  FoxO signaling pathway
mna04136  Autophagy - other
mna04137  Mitophagy - animal
mna04140  Autophagy - animal
mna04371  Apelin signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04727  GABAergic synapse
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107524724 (GABARAPL2)
   04068 FoxO signaling pathway
    107524724 (GABARAPL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107524724 (GABARAPL2)
   04136 Autophagy - other
    107524724 (GABARAPL2)
   04137 Mitophagy - animal
    107524724 (GABARAPL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107524724 (GABARAPL2)
  09156 Nervous system
   04727 GABAergic synapse
    107524724 (GABARAPL2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107524724 (GABARAPL2)
   05022 Pathways of neurodegeneration - multiple diseases
    107524724 (GABARAPL2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107524724 (GABARAPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107524724 (GABARAPL2)
   04121 Ubiquitin system [BR:mna04121]
    107524724 (GABARAPL2)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107524724 (GABARAPL2)
Membrane trafficking [BR:mna04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    107524724 (GABARAPL2)
Ubiquitin system [BR:mna04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   107524724 (GABARAPL2)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107524724 (GABARAPL2)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 107524724
NCBI-ProteinID: XP_016052229
LinkDB
Position
Unknown
AA seq 117 aa
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIVRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagtggatgtttaaggaggaccactcgctggaacacagatgcgtggaatccgcgaag
atccgagcgaaatatcccgaccgggttccggtgattgtggaaaaagtctcaggctctcag
attgttgacattgacaaacggaagtatctggttccatctgacatcactgtggctcagttc
atgtggatcgtcaggaaaaggatccagcttccttctgaaaaggcaatcttcctgtttgtg
gataagacagtcccacagtccagcctaactatgggacaactttatgagaaggaaaaagat
gaagatggattcttgtacgtggcctacagtggagagaacacgtttggcttctaa

KEGG   Miniopterus natalensis: 107544101
Entry
107544101         CDS       T05883                                 

Gene name
GABARAPL1
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
mna  Miniopterus natalensis
Pathway
mna04068  FoxO signaling pathway
mna04136  Autophagy - other
mna04137  Mitophagy - animal
mna04140  Autophagy - animal
mna04371  Apelin signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04727  GABAergic synapse
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107544101 (GABARAPL1)
   04068 FoxO signaling pathway
    107544101 (GABARAPL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107544101 (GABARAPL1)
   04136 Autophagy - other
    107544101 (GABARAPL1)
   04137 Mitophagy - animal
    107544101 (GABARAPL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107544101 (GABARAPL1)
  09156 Nervous system
   04727 GABAergic synapse
    107544101 (GABARAPL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107544101 (GABARAPL1)
   05022 Pathways of neurodegeneration - multiple diseases
    107544101 (GABARAPL1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544101 (GABARAPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544101 (GABARAPL1)
   04121 Ubiquitin system [BR:mna04121]
    107544101 (GABARAPL1)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107544101 (GABARAPL1)
Membrane trafficking [BR:mna04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    107544101 (GABARAPL1)
Ubiquitin system [BR:mna04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   107544101 (GABARAPL1)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107544101 (GABARAPL1)
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 107544101
NCBI-ProteinID: XP_016077357
LinkDB
Position
Unknown
AA seq 117 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttccagtataaggaggaccatccctttgagtatcggaaaaaggaaggagaaaag
atccggaagaaatacccggacagggtccctgtgatcgtggagaaggctcccaaggccaga
gtgcctgatctggacaagaggaagtacctagtgccctctgacctcactgttggccagttc
tacttcttaatccggaagaggatccacctgcgacctgaggacgccttattcttttttgtc
aacaacactatccctcccaccagcgccaccatgggccagctgtatgaggacaaccatgag
gaagactactttctgtatgtggcctacagtgatgagagtgtgtatgggaaatga

KEGG   Miniopterus natalensis: 107544523
Entry
107544523         CDS       T05883                                 

Gene name
GABARAP
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
mna  Miniopterus natalensis
Pathway
mna04068  FoxO signaling pathway
mna04136  Autophagy - other
mna04137  Mitophagy - animal
mna04140  Autophagy - animal
mna04371  Apelin signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04727  GABAergic synapse
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107544523 (GABARAP)
   04068 FoxO signaling pathway
    107544523 (GABARAP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107544523 (GABARAP)
   04136 Autophagy - other
    107544523 (GABARAP)
   04137 Mitophagy - animal
    107544523 (GABARAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107544523 (GABARAP)
  09156 Nervous system
   04727 GABAergic synapse
    107544523 (GABARAP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107544523 (GABARAP)
   05022 Pathways of neurodegeneration - multiple diseases
    107544523 (GABARAP)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544523 (GABARAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544523 (GABARAP)
   04121 Ubiquitin system [BR:mna04121]
    107544523 (GABARAP)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107544523 (GABARAP)
Membrane trafficking [BR:mna04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    107544523 (GABARAP)
Ubiquitin system [BR:mna04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   107544523 (GABARAP)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107544523 (GABARAP)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 107544523
NCBI-ProteinID: XP_016077907
LinkDB
Position
Unknown
AA seq 117 aa
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtataaagaggagcatccgttcgagaaacgccgctctgagggcgagaag
atccgaaagaaatacccggaccgggtcccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatctcacagttggtcagttt
tatttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccaccatgggtcagctataccaggaacaccatgaa
gaagacttctttctatacattgcctacagtgatgaaagtgtctatggcctgtga

DBGET integrated database retrieval system