KEGG   Miniopterus natalensis: 107524832
Entry
107524832         CDS       T05883                                 

Gene name
CD28
Definition
(RefSeq) T-cell-specific surface glycoprotein CD28
  KO
K06470  CD28 antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04660  T cell receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05162  Measles
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05320  Autoimmune thyroid disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107524832 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107524832 (CD28)
   04672 Intestinal immune network for IgA production
    107524832 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107524832 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    107524832 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107524832 (CD28)
   05323 Rheumatoid arthritis
    107524832 (CD28)
   05320 Autoimmune thyroid disease
    107524832 (CD28)
   05330 Allograft rejection
    107524832 (CD28)
   05332 Graft-versus-host disease
    107524832 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107524832 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107524832 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107524832 (CD28)
CD molecules [BR:mna04090]
 Proteins
  107524832 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 107524832
NCBI-ProteinID: XP_016052372
LinkDB
Position
Unknown
AA seq 221 aa
MILRLLLALNFFPSIQVAEDKILVKQSPMLVVHNNAVNLSCNYTYNLFSKEFRASLYKGA
DSAVEVCVVNGNYSHQLQFRSKTGFNCDGKLGNETVTFYLWNLFVNQTDIYFCKIEVMYP
PPYIDNEKSNGTIIHVKENQLCPAHRTPESSKPFWALVVVGGVLTLYSMLVTVALFTYWM
KNKRNRILHSDYLNMTPRRQGPTRQHYYPYVPSRDFAAYRS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgatcctcaggctgctcctggctctcaacttcttcccttcaattcaagtagcagaagac
aagattttggtgaagcagtcccccatgcttgtagtgcacaacaatgctgtcaaccttagc
tgcaattatacctacaacctcttttcaaaggagttccgggcatccctttataagggagca
gacagtgctgtggaagtctgtgttgtgaatggaaattactcccatcagcttcagtttcgc
tcaaaaacaggattcaactgtgatgggaaattgggcaacgaaacagtgacattctacctc
tggaatttgtttgttaaccaaacggatatttacttctgcaaaatagaggtcatgtaccct
cctccatacatagacaatgagaagagcaatggaaccattatccatgtgaaagagaatcag
ctttgtccagctcaccgaactccggagtcttctaagccattttgggcactggtggttgtt
ggtggagtcttgactctgtatagcatgctagtaacagtggctctttttacttactggatg
aagaataagagaaacaggatccttcacagcgactacctcaacatgaccccccggaggcag
gggcccacccgacagcactactatccttatgttccatctcgagactttgctgcataccgc
tcctga

DBGET integrated database retrieval system