KEGG   Miniopterus natalensis: 107524880
Entry
107524880         CDS       T05883                                 

Gene name
CFTR
Definition
(RefSeq) cystic fibrosis transmembrane conductance regulator
  KO
K05031  cystic fibrosis transmembrane conductance regulator [EC:5.6.1.6]
Organism
mna  Miniopterus natalensis
Pathway
mna02010  ABC transporters
mna04024  cAMP signaling pathway
mna04152  AMPK signaling pathway
mna04530  Tight junction
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107524880 (CFTR)
  09132 Signal transduction
   04024 cAMP signaling pathway
    107524880 (CFTR)
   04152 AMPK signaling pathway
    107524880 (CFTR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107524880 (CFTR)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    107524880 (CFTR)
   04972 Pancreatic secretion
    107524880 (CFTR)
   04976 Bile secretion
    107524880 (CFTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107524880 (CFTR)
Enzymes [BR:mna01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.6  channel-conductance-controlling ATPase
     107524880 (CFTR)
Transporters [BR:mna02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC7 subgroup
    107524880 (CFTR)
SSDB
Motif
Pfam: CFTR_R ABC_membrane ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase T2SSE AAA_16 DUF87 Zeta_toxin AAA_30 MMR_HSR1 MeaB NTPase_1 DUF4181 Intein_splicing DUF4446
Other DBs
NCBI-GeneID: 107524880
NCBI-ProteinID: XP_016052415
LinkDB
Position
Unknown
AA seq 1482 aa
MQRSPLEKASVISKLFFSWTTPILKKGYRQRLELSDIYQIPSADSADNLSETLEREWDRE
LASKKNPKLINALRRCFFWRFMFYGILLYLGEVTKAVQPLLLGRIIASYDPDNKVERSIA
VYLGIGLCLLFILRTLLLHPAIFGLHHIGMQIRIAMFSLIYKKTLKLSSRVLDKISIGQL
VSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWELLQASAFCGLAFLIVLAIVQAGL
GRMMMKYRDQRAGKINERLVITSEIIENIQSVKAYCWEEAMEKMIENIRQTELKLTQKAA
YVRYFNSSAFFFSGFFVVFLSVLPYALNKGIILRKIFTTISFCIVLRMAVTRQFPWAVQT
WYDSLGAISKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFENAKQNNNNRN
IYSGDNSVFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG
KIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV
LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR
ILVTSKMEHLKKADKILILHEGKSYFYGTFSELQNLRPDFNSKILGYDYFDQFSAERRNS
ILTETLRRFSLEGDAAIPRKETKKQSFKQTGEFGENRKNSILNPINSLKKFSIVQKTPLQ
MNGIEEDSEEPSERRLSLVPDSEQGEAILPRSNVINTGPTFQRRRRQSVLNLMTRSSVNQ
GQLIHRNRAASTRKMSLAPQGDLAEMNIYSRRLSQDSSLEISEEINEEDLKECFFDDVES
IPSVTTWNTYLRYVTVHKNLIFVLIWCLVIFLAEVAVFLVVLRLLKQTPSQDKGNSIGST
NNSYAVIITNTSSFYVFYIYVGVADTLLALGFFRGLPLVHSLITVSKILHHKMLHSVLHA
PMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLVLIVIGAVVVVSVLEPYIFLAT
VPVIAAFIMLRAYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFEILFH
KALNLHTANWFLYLSTLRWFQMRIEIIFVIFFIAVTFISILTTGEREGTIGIVLTLAMNI
MGTLQWAINSSIDVDSLMRSVSRVFKFIDMQTEESKSTMSSKPSTDSQLSKVMIIENQHL
KKDDIWPSGGQMTVKDLTAKYIDSGTAILENISFSISPGQRVGLLGRTGSGKSTLLSAFL
RLLNTEGEIQIDGVSWDSITLQEWRKAFGVIPQKVFIFSGTFRKNLDPYEQWNDQEIWKV
VDEVGLKSVIEQFPGKLDFILLDGGFVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDP
VTYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYDSIQKLLSEKSLFQ
QAMSPSDRLKLSPHRNSSKHKSRSKITALKEETEEEVQETRL
NT seq 4449 nt   +upstreamnt  +downstreamnt
atgcagaggtcgcctctggaaaaggccagcgtcatctccaaactttttttcagctggact
acaccaattttgaagaaagggtacagacagcgcctggagttgtcagacatataccaaatc
ccttcagctgattctgctgacaatctctctgaaacattagaaagagaatgggacagagag
ctggcatcaaagaaaaatcccaaactcattaatgcccttcggagatgctttttctggaga
tttatgttctatggaatcttattatatttaggggaggtcaccaaagcagtccagcctctt
ttactgggaagaatcatagcttcctatgatccagataataaagtggaacgctccatcgcg
gtttacctaggcatagggttatgccttctttttatcctgaggacactgctactgcaccca
gccatttttggccttcatcacattggaatgcaaataaggatagctatgtttagtttgatt
tataagaagactttaaagctgtcaagccgtgttctagataaaatcagcattggacaactt
gttagtctcctttcgaataacttgaacaaatttgatgaaggacttgcattggcacatttc
gtgtggatcgctcctttacaagtgacactcctgatggggctgctttgggaattgttacag
gcctctgccttctgtggacttgctttcctcatagtcctcgccattgtccaagctgggctg
gggagaatgatgatgaagtacagagatcagagagctgggaaaatcaatgaaagactcgtg
atcacctcagaaattattgaaaatatccaatctgttaaggcatactgctgggaggaagca
atggaaaaaatgattgaaaacataaggcaaacagaactgaaactgacccagaaggcagcc
tatgtgagatacttcaatagctcagccttcttcttctcagggttctttgtggtgttttta
tctgtgcttccctatgcattgaacaaaggaatcatccttcgaaaaatattcacgaccatc
tcattctgcattgttctgcgcatggcagtcactcggcaattcccctgggctgtacaaaca
tggtatgattctcttggagcaataagcaaaatacaggatttcttacaaaagcaagagtat
aagacattggaatataacttaacaactacagaagtagtgatggagaacgtaacagctttc
tgggaggagggatttggggaattatttgagaatgcaaaacaaaacaataataatagaaac
atttacagtggtgataacagcgtcttcttcagtaacttctcacttcttggtactcctgtc
ctgaaagatattaatttcaagatagaaagaggacagttgttggcagttgctggatctact
ggagcaggcaagacttcacttctgatgatgattatgggagaactggagccttctgagggt
aaaattaaacacagtggaagaatttcattctgctctcagttttcatggatcatgcctggc
accattaaagaaaacattatctttggtgtttcctatgatgagtatagatataggagtgtc
atcaaagcatgtcaactagaagaggacatctccaagtttgcagagaaagacaatatagtc
cttggagaaggtggaatcacactgagtggagggcagcgagcaagaatttctctagcaaga
gcagtatataaggatgctgatttgtacttattagactctcctttcggatacctagatgtt
ttaacagaaaaagaaatatttgaaagctgtgtctgtaaattgatggctaacaaaactagg
atcttggtcacttctaaaatggaacatttaaagaaagctgacaaaatattaattttacat
gaaggtaaaagctatttttatgggacattttctgaattacaaaatctacggcctgacttc
aactcaaagatcctggggtatgattattttgaccagtttagtgcagaaagaagaaattca
atcctaactgagactttacggcgtttctcattagaaggagatgctgccatcccccggaag
gaaacaaaaaaacagtctttcaaacagactggagagtttggtgaaaataggaagaactct
attctcaatccaatcaactctttaaaaaaattttcaattgtgcaaaagactccattgcaa
atgaatggcattgaagaagattctgaagagccttcagagagaaggctgtccttggttccc
gactctgagcagggagaggctatcctgccccgaagtaacgtgattaacactggtcccacg
tttcaaaggcgaaggaggcagtctgtcctgaacctgatgacacgctcttcagtgaaccaa
ggtcaactcattcaccgaaacagagctgcatccacacggaaaatgtcactggcccctcag
ggggacttagcggaaatgaatatatattcaaggcgtttatctcaagatagtagtttagaa
ataagtgaagaaattaatgaagaagatttaaaggagtgcttttttgatgatgtggagagc
ataccatcagtgactacatggaacacataccttagatatgttactgtccacaagaactta
atttttgtgctaatttggtgtttagttatttttctggctgaggtggctgtttttttggtt
gttttgcggctacttaaacaaacaccttctcaagacaaagggaatagtattgggagtaca
aataacagctatgcagtgatcatcaccaacaccagctcattttatgttttttacatttat
gtgggagtagccgacactttgcttgctctgggattcttccgaggtttaccactagtgcat
tctctaatcacagtgtcaaaaattttacaccacaaaatgttacattctgttctccatgca
cctatgtcaaccctcaacacgttgaaagcaggtgggattcttaatagattttccaaagat
atagcaattttggacgatcttctgcctcttaccatatttgacttcatccagttggtatta
attgtgattggagctgtagtagtcgtctccgttttagagccctacatcttcttagcaaca
gtgccagtgatcgctgcttttattatgttgagagcctacttcctccacacctcccagcaa
ctcaaacaactggaatctgaaggcaggagtccaattttcactcatctggttacaagctta
aaaggactatggacacttcgtgcctttggacgtcagccttactttgaaatactattccac
aaagctttgaatttacatactgccaactggttcttgtacctgtcaacactgcgctggttc
caaatgagaatagaaattatttttgtcatcttcttcattgctgttaccttcatttctatt
ttaacaacaggtgaaagagaaggaacaataggtatcgtcctaacattagccatgaatatc
atgggtacattgcagtgggctataaactccagcatagatgtggatagtttgatgcgatct
gtgagccgagtctttaagtttatagacatgcaaacagaagaaagtaaatctaccatgtca
agcaaaccatccacggacagccagctctcgaaagttatgattattgagaatcagcacttg
aagaaagatgacatctggccctcagggggccaaatgaccgtcaaagaccttacagcaaaa
tatatagacagtgggactgccatattagagaacatttccttctcaataagtcccggccag
agggtgggcctcttgggaagaactggatcagggaagagcactttgttatcagcttttttg
agactgttgaacaccgaaggagaaattcaaatagatggtgtgtcttgggattcaataact
ttgcaagagtggagaaaagcctttggagttataccacagaaagtatttatcttctctgga
acatttagaaaaaacttggatccctacgaacagtggaatgatcaagaaatatggaaagtt
gtagatgaggttggactcaaatctgtgatagagcaatttcctgggaagcttgattttatc
cttttggatgggggttttgtcctaagccatggccacaagcagttgatgtgcttggccaga
tctgttctcagtaaggcaaagatcttgctgcttgatgaacccagtgctcatttggatcca
gtaacatatcaaatcattcgaagaaccctaaaacaagcatttgctgattgcacagtgatc
ctttctgaacacaggatagaggcaatgttggaatgtcaacgatttttggtcatagaggag
aacaaagtgcggcagtatgattccatccagaaactgctgagtgagaagagcctcttccag
caggccatgagcccctcggaccgactgaagctctcaccccaccggaactcaagcaagcac
aagtctcgatccaaaatcactgctctgaaagaggagacagaagaagaggtgcaagaaacc
aggctttag

DBGET integrated database retrieval system