KEGG   Miniopterus natalensis: 107524904
Entry
107524904         CDS       T05883                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04020  Calcium signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04066  HIF-1 signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04072  Phospholipase D signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04625  C-type lectin receptor signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04750  Inflammatory mediator regulation of TRP channels
mna04919  Thyroid hormone signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05223  Non-small cell lung cancer
mna05225  Hepatocellular carcinoma
Module
mna_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107524904 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107524904 (PLCG2)
   04014 Ras signaling pathway
    107524904 (PLCG2)
   04370 VEGF signaling pathway
    107524904 (PLCG2)
   04064 NF-kappa B signaling pathway
    107524904 (PLCG2)
   04066 HIF-1 signaling pathway
    107524904 (PLCG2)
   04020 Calcium signaling pathway
    107524904 (PLCG2)
   04070 Phosphatidylinositol signaling system
    107524904 (PLCG2)
   04072 Phospholipase D signaling pathway
    107524904 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107524904 (PLCG2)
   04613 Neutrophil extracellular trap formation
    107524904 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    107524904 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    107524904 (PLCG2)
   04662 B cell receptor signaling pathway
    107524904 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    107524904 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    107524904 (PLCG2)
   04670 Leukocyte transendothelial migration
    107524904 (PLCG2)
   04062 Chemokine signaling pathway
    107524904 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107524904 (PLCG2)
   04919 Thyroid hormone signaling pathway
    107524904 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107524904 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107524904 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    107524904 (PLCG2)
   04380 Osteoclast differentiation
    107524904 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524904 (PLCG2)
   05206 MicroRNAs in cancer
    107524904 (PLCG2)
   05205 Proteoglycans in cancer
    107524904 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107524904 (PLCG2)
   05214 Glioma
    107524904 (PLCG2)
   05223 Non-small cell lung cancer
    107524904 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107524904 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107524904 (PLCG2)
   05171 Coronavirus disease - COVID-19
    107524904 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107524904 (PLCG2)
   05169 Epstein-Barr virus infection
    107524904 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107524904 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107524904 (PLCG2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107524904 (PLCG2)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107524904 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107524904 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 107524904
NCBI-ProteinID: XP_016052457
LinkDB
Position
Unknown
AA seq 1265 aa
MTTMANVDALPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKSSKDFERAKAVRQKEECCFTILYGTQFVLSTLSLAADSKEDAT
KWLSGLKLLHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKAILPLVNFKVSSA
RFLKDKFTEIGVHKDEFSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCGVEQQRYMARV
FKEVFGDLLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEQKQQGE
LYMWDPIDLKWTRHYCAVADAKLSFSDDIEQTVEEELPQDTPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCSETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTVEGGTMKYY
LTDNLMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMKLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTKIQHYFPSNYVEDISTVDVEELEKQII
EDNPLGSLCKGILDLNTYNVVKAPHGKNQKPFVFILEPKKQGDPPVEFATDKVEELFEWF
QSIRQITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPIELLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNQALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWASTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVREFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaccaccatggccaacgtggacgccctcccggaatatgagaagagtcagatcaagaga
gccctggagctgggcacagtgatgaccgtgttcagcttccgcaagtccacgccggagcgc
aggaccgtccaggtgatcatggagacgcggcaggtggcctggagtaagacggccgacaag
atcgagggcttcttggatatcatggaaatcaaggagatccgcccagggaagagctccaag
gattttgagcgcgccaaagcagtccgccagaaggaagaatgctgcttcaccatcttgtat
ggcacccagtttgtcctcagcacactcagtttagcagctgactctaaggaagatgcaacc
aagtggctctctggcttgaaactcttacaccaagaagcgatgaatgcatccacacccacc
attattgagagttggctgagaaagcagatttattcggtggatcaaaccagaagaaacagc
atcagcctccgagagctgaaggccatcttgcccctggtcaacttcaaagtgagcagtgcc
aggtttctcaaggataagtttacggaaataggtgtgcacaaagatgaattcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaatcgattcttgatgaa
ttcaaaaaagattcctccgtgttcatcttgggcaacaccgaccggcccgacgcctccgct
gttcacctgcatgacttccagcggtttctcctgcacgagcagcaggaactttgggctcag
gatctgaacaaagtccgtgagaggatgaccaagtttatcgacgacacgatgagggagact
gcggagcccttcttgtttgttgatgagttcctcacgtacctgttttcccgggagaacagc
atttgggacgagaagtatgacgtggtggacatgcaggacatgaacaaccccttgtcgcat
tactggatctcctcatcacataacacgtacctcacaggtgaccagctgcggagtgagtca
tccacggaggcctatatccgctgtctgcgcatgggctgtcgctgcattgagctggactgc
tgggacgggcccgacgggaagcccatcatctaccacggctggacgcggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacctcaagcttcccc
gtgatcctgtccattgaggagcactgcggtgtggagcagcagcgctacatggccagagtg
ttcaaggaggtgtttggcgacctgctgctgatgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgcggtgatgtcgatgtcaacatggaggacaagaaagatgagcagaagcaacagggtgaa
ctgtacatgtgggatcccattgacctgaaatggactcggcactattgcgccgtcgcagat
gccaagctgtccttcagcgatgacattgaacagactgtggaagaggaactgccccaggac
acaccccccacagagctgcattttggggagaagtggttccataagaaggtggagaagagg
acaagtgctgagaagctgttgcaggaatactgctctgagacggggggcaaggatgggacc
ttcctggtgcgggagagcgagacattccccaacgactacaccctgtccttctggcgctcg
ggccgggtccagcactgtcgcatccggtccaccgtggagggcggcaccatgaagtactac
ctgactgacaacctcatgttcaccagcatctacgcgctcatccagcactaccgcgagacg
cacctgcgctgcgccgagttcgagctgcgcctcaccgaccccgtgcccaaccccaacccc
cacgagtccaagccatggtactacgacgggctgagtcgcggagaagcggaggacatgctg
atgcgggtcccccgggacggcgccttcctcatccggaagcgggaaggcagcgactcctac
gccatcaccttcagggcccggggcaaggtgaagcactgtcgaatcaaccgggacggccgg
cacttcgtgctggggacctccgcctacttcgagagcctggtggagctcgtcagttactac
gagaagcacgccctctaccgcaagatgaaactgcgctaccccgtgactcctgagctcctg
gagcgctacaacatggaaagagatataaactccctgtatgacgtcagcagaatgtatgtg
gatcccagtgaaatcaatccttctatgcctcagagaaccgtgaaagcgctgtatgactac
aaagctaagcagagtgacgagctgagcttctgccgcggcgccctcattcacaacgtctcc
aaggagcccgggggctggtggaaaggagactacggaaccaaaatccagcactacttcccc
tccaattacgtcgaggacatttcaacggttgatgtggaagagctggagaagcagattatt
gaagacaatcccttagggtctctttgcaaaggaatattggatctcaacacttataacgtt
gtgaaagccccacatggcaaaaaccagaagcctttcgtctttatcctggagcccaagaag
caaggtgaccctccggtggagtttgccacggacaaggtagaggagctgttcgaatggttt
cagagcatccggcagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtcgatcgccatcgagctctcggacctggtcgtctactgcaaaccaacc
agcaagaccaaagacaatttagagaatcccgacttccgagaaatccgttcctttgtggag
acgaaggctgacagtgtcgtcagacagaaacccattgaactcctgaagtacaatcagaag
ggtctgacccgtgtttacccgaagggacagagggtggactcctccaactacgatcccttc
cgtctctggctgtgtggctcccaaatggtggcactcaatttccagactgcagataaatac
atgcagatgaaccaggccttgttttcactcaacgggaggactggctacgtcctacaaccc
gagagcatgaggacggagaagtacgaccccatgccacctgagtcccagaggaagatcctg
atgaccttgacggtcaaggttctcggggcccgccatctccccaagctcgggcgaagtatt
gcatgtccttttgtggaggtggagatatgtggagccgagtatgacaacaacaagttcaag
acgacggttgtgaatgacaacggcctaagccctgtttgggcttcaacacaggagaaggtg
acatttgaaatttatgatccaaacctcgcgtttctgcgcttcgtggtgtacgaggaagat
atgttcagcgaccccaactttcttgctcatgctacttaccccattaaaggaatcaaatca
ggatttagatctgttcctctgaagaatgggtacagtgaagacattgagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagtgaagaggaactgtactcctcttgt
cgccagctacggaggcggcaagaagagctgaacaaccagctctttctatatgacacacac
cagaacttgcgcaatgccaaccgggatgccctcgttagagagttcaatgtcaatgagaac
cagcttcagctgtaccaggagaagtgcaaccggaggttaagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Miniopterus natalensis: 107542131
Entry
107542131         CDS       T05883                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04066  HIF-1 signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04072  Phospholipase D signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04613  Neutrophil extracellular trap formation
mna04650  Natural killer cell mediated cytotoxicity
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04750  Inflammatory mediator regulation of TRP channels
mna04919  Thyroid hormone signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05012  Parkinson disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05135  Yersinia infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05223  Non-small cell lung cancer
mna05225  Hepatocellular carcinoma
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
mna_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107542131 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107542131 (PLCG1)
   04014 Ras signaling pathway
    107542131 (PLCG1)
   04015 Rap1 signaling pathway
    107542131 (PLCG1)
   04370 VEGF signaling pathway
    107542131 (PLCG1)
   04064 NF-kappa B signaling pathway
    107542131 (PLCG1)
   04066 HIF-1 signaling pathway
    107542131 (PLCG1)
   04020 Calcium signaling pathway
    107542131 (PLCG1)
   04070 Phosphatidylinositol signaling system
    107542131 (PLCG1)
   04072 Phospholipase D signaling pathway
    107542131 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542131 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    107542131 (PLCG1)
   04660 T cell receptor signaling pathway
    107542131 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    107542131 (PLCG1)
   04659 Th17 cell differentiation
    107542131 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    107542131 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    107542131 (PLCG1)
   04670 Leukocyte transendothelial migration
    107542131 (PLCG1)
   04062 Chemokine signaling pathway
    107542131 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107542131 (PLCG1)
   04919 Thyroid hormone signaling pathway
    107542131 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107542131 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107542131 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    107542131 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542131 (PLCG1)
   05206 MicroRNAs in cancer
    107542131 (PLCG1)
   05205 Proteoglycans in cancer
    107542131 (PLCG1)
   05231 Choline metabolism in cancer
    107542131 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107542131 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107542131 (PLCG1)
   05214 Glioma
    107542131 (PLCG1)
   05223 Non-small cell lung cancer
    107542131 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107542131 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    107542131 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107542131 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107542131 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107542131 (PLCG1)
   05171 Coronavirus disease - COVID-19
    107542131 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107542131 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107542131 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107542131 (PLCG1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107542131 (PLCG1)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107542131 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107542131 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 107542131
NCBI-ProteinID: XP_016074844
LinkDB
Position
Unknown
AA seq 1257 aa
MTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQ
EDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIE
RWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFA
QLYRSLMYSAQKTMDLPFLEASTLRAGERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQ
EFMLDFLRDPLREIEEPYFFLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSS
HNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVL
HTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQ
LKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTS
SKIYYSEETSSDQGNEDEEEPKEASGSTELHSNEKWFHGKLGAGRDGRHIAERLLTDYCT
ETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYD
LITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVR
KRNEPNSYAISFRAEGKIKHCRVQQEGQMVMLGNSEFDSLVDLISYYEKHPLYRKMKLRY
PINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQRDDELTFTK
SAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMVSPAALEPEREHLDENSPLGDLLRG
VLDVPACQIAIRPEGKNSRLFVFSISMASVSQWSLDVAADSQEELQDWVKKIREVAQTAD
ARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNK
AKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALF
MTGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEI
EVAGAEYDNNKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLA
QATFPVKGLKTGYRAVPLKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGS
DASGQLFHGRAREGSFEARYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgactttgttctactccaagaagtcgcagcggcccgagcggaagaccttccaggtcaag
ttggagactcggcagatcacgtggagccgcggcgccgacaagatcgagggggccattgac
attcgagaaatcaaggagatccgcccagggaagacctctcgggactttgatcgctaccaa
gaggaccctgctttccgaccagaccagtcacactgctttgtcatcctgtatgggatggaa
ttccgcctgaagaccctgagtctgcaagctacatctgaggatgaagtgaacatgtggatc
aagggcttgacttggctgatggaggatacattgcaggcagccacacccctacagattgag
aggtggctgcggaagcagttctactcggtggatcggaatcgtgaggatcgtatatcagcc
aaggacctgaagaatatgctgtcccaggtcaactaccgggtccccaacatgcgcttcctc
cgagagcggctgacggacttggagcagcgcagtagcgacatcacctacgggcagtttgct
caactgtaccgcagcctcatgtacagcgcccagaagacgatggaccttcccttcttggaa
gccagcaccctgagggcgggggagcggccggagctctgcagagtgtcccttccggagttc
cagcagttcctcctcgagtaccagggggagctgtgggctgtggaccggctccaggtgcag
gagttcatgctcgacttcctccgagaccccttgcgagagatcgaggagccatacttcttc
ctggacgagtttgtcaccttcctgttctccaaagagaacagcgtgtggaactcgcagctg
gatgcagtgtgcccggacaccatgaacaaccctctctcccactactggatctcctcctcg
cataacacgtacctgaccggggaccagttctccagcgagtcttccctggaagcctacgct
cgctgcctacgcatgggctgtcgctgcattgagttggactgctgggatggcccggacggg
atgccagtcatttaccatggacacacccttaccaccaagatcaagttttcagatgtactg
cacaccatcaaggagcatgcctttgtggcctcagagtacccggtcatcctgtccattgag
gaccactgcagcattgcgcagcagaggaacatggcccagtacttcaagaaggtgctcggg
gacacactcctcaccaagcccgtggacattgccgccgatgggctcccttcacccaaccag
ctcaagaggaagatccttattaagcacaagaagctggctgaaggcagtgcctatgaggag
gtgcctacatctgtgatgtactctgagaacgacatcagcaactccatcaagaatggcatt
ctctacctggaggaccccgtgaaccatgagtggtatcctcattacttcgttctgaccagc
agcaagatctactattccgaggagaccagcagtgaccagggcaatgaggatgaggaagag
cccaaggaggccagtggcagcacagagctgcactccaatgagaaatggttccacgggaag
ctcggggcaggacgggatgggcggcacatcgctgagcgcctgctgaccgactactgcact
gagactggggcccccgatggctcctttctagtacgcgagagcgagaccttcgtgggcgac
tacaccctctctttctggcggaacgggaaagtccaacactgccggatccactcccgacag
gacgctgggacccccaagttcttcttgacagacaacctcgtatttgattcactctatgac
ctcatcacacactaccagcaggtgcccctgcgctgcaacgaatttgagatgcgcctctcg
gagcccgtcccgcagaccaatgcccacgaaagcaaagagtggtaccatgcgagtctgacg
agagcacaggccgagcacatgctgatgcgtgtcccccgtgatggggccttcctggtgcga
aaacggaatgaacccaactcttacgccatctccttccgggctgagggcaagatcaagcat
tgccgcgtccagcaggagggccagatggtgatgctgggcaactcagagtttgacagcctc
gtcgacctcatcagctactatgagaagcatccactgtaccgaaagatgaagctgcgctat
cccatcaatgaggaggcactggagaagattggcacagctgaacctgactatggggccttg
tatgagggacgcaaccctggcttttatgtggaggcaaaccctatgccgacttttaagtgt
gcggtcaaagccctctttgactacaaggcccagagagacgatgagctgactttcaccaag
agtgccatcatccagaatgtggagaagcaggatggaggctggtggcggggagactatggt
gggaagaagcagctctggttcccgtcaaactacgtggaggaaatggtcagcccagcagcc
ctggagcctgagagggagcacttggacgagaacagccccttgggggacttgctgcgggga
gtcttggatgtgccagcttgtcagattgccatccgtcctgagggcaagaacagccggctc
ttcgtcttctccatcagtatggcgtcggtgtcacagtggtccctggatgttgctgctgac
tcacaggaagaattgcaggactgggtgaaaaagatccgagaagtggcccagaccgcagat
gccaggctcactgaggggaagatgatggaacggaggaagaagattgccctggagctatcc
gagcttgttgtctactgtcggcctgtccccttcgatgaagagaaaattggcacggaacgt
gcctgctaccgggacatgtcatccttcccggaaaccaaggctgagaagtatgtgaacaag
gccaaaggcaagaagttcctgcagtacaaccggctgcagctctcccgcatctaccccaag
ggccagcggctggactcttccaattacgaccccttgcccatgtggatctgtggcagtcag
ctggtggccctcaacttccagaccccagacaagcccatgcagatgaaccaggccctcttc
atgactggcgggcactgtggctatgtgctgcagcccagcaccatgcgggatgaggccttc
gacccctttgacaagagcagcctccgtgggctggagccatgcgccatctgcatcgaggtg
ctgggcgcccggcatctgccaaagaatggccgaggcattgtgtgtccctttgtggagatt
gaggtggctggtgctgagtatgacaacaacaagcaaaagacagagtttgtggtggacaac
ggcctgaaccctgtgtggccggccaagcccttccacttccagatcagcaaccctgagttc
gctttcctgcgctttgtggtgtatgaggaagacatgtttagtgaccaaaacttcctggct
caggctactttcccagtaaaaggcctgaagacagggtacagagcggtgcctttgaagaac
aactacagtgaggacctggagttggcttccctgctgatcaagattgacattttccctgcc
aagcaggagaacggtgacctcagtcccttcagtggcacatccctgcgggagcggggctcc
gatgcctcgggccagctgtttcatggccgggcccgtgaaggctcctttgaagctcgctac
cagcagccatttgaggactttcgcatctcccaggagcatcttgctgaccattttgacagc
cgggagagaagggccccacgaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system