KEGG   Miniopterus natalensis: 107524905
Entry
107524905         CDS       T05883                                 

Gene name
SLC4A2
Definition
(RefSeq) anion exchange protein 2
  KO
K13855  solute carrier family 4 (anion exchanger), member 2
Organism
mna  Miniopterus natalensis
Pathway
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107524905 (SLC4A2)
   04971 Gastric acid secretion
    107524905 (SLC4A2)
   04972 Pancreatic secretion
    107524905 (SLC4A2)
   04976 Bile secretion
    107524905 (SLC4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107524905 (SLC4A2)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   107524905 (SLC4A2)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Other DBs
NCBI-GeneID: 107524905
NCBI-ProteinID: XP_016052455
LinkDB
Position
Unknown
AA seq 1238 aa
MSSAPRRPASGADSFRTPEPESAGPPAPGFPEQEEDELHRTLGVERFEEILLEAGEEPGR
CYGEEDFEYHRQSSHHIHHPLSTHLPPDTRRRKTPQGPGRKPRRRPGASPTGETPTIEEG
EEDEDEASEAEGARALTQPTPAPVPSSVQFFLQEDEGTDRKAERTSPSPPPPPPHQEAAP
RATKGAQTGAMVEEVVAVASGTAGGDDGGAPGRPLTKAQPGHRSYNLQERRRIGSMTGAE
QALLPRVPTDESEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKASGQSGREGRDPGP
TPRGRPRAPHKPHEVFVELNELLLDKNQEPQWRETARWIKFEEDVEEETERWGKPHVASL
SFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHS
HPSDEKEFSFPRNISAGSLGSLLGHHHGQGAESDPHVTEPLIGGVPETRLEVERERELPP
PAPTAGITRSKSKHELKLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLE
VPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDC
SVVLPPSEVQGEELLRSVAHFQRQMLKKREEQGRLLPPGAGLEPKSAQDKALLQMVEATG
TVEDDPLRRTGRPFGGLIRDVRRRYPHYLSDFRDALDPQCLAAVIFIYFAALSPAITFGG
LLGEKTQDLIGVSELIMSTALQGVIFCLLGAQPLLVIGFSGPLLVFEEAFFSFCKSNNLE
YLVGRVWIGFWLVLLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQ
EHPLHGCSVSNSSEADSGEADIGDNTTWAGAGATLGPGNGSSTGPPGQGRPQGQPNTALL
SLVLMAGTFFIAFFLRKFKNSRFFPGRVRRVIGDFGVPIAILIMVLVDYSIEDTYTQKLS
VPDGFSVTAPQKRGWVINPLGENSSFPVWMMVASLLPAILVFILIFMETQITTLIISKKE
RMLQKGSGFHLDLLLIVAMGGICALFGLPWLAAATVRSVTHANALTVMSKAVAPGDKPKI
QEVKEQRVTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLL
MPPKHHPDVTYVKKVRTLRMHLFTALQLLCLALLWAVMSTAASLAFPFILILTVPLRMVV
LTRIFTEREMKCLDANEAEPVFDEREGVDEYNEMPMPV
NT seq 3717 nt   +upstreamnt  +downstreamnt
atgagcagcgcccccaggcgccccgcctcgggcgcagattctttccgaactccagagcca
gagagcgcaggcccccctgcgcctgggttccccgagcaggaggaagatgagcttcaccgc
accctgggcgtggagcggtttgaggagatccttctggaggccggggaggagccaggccgc
tgctatggggaggaagactttgaataccaccgccagtcctcccatcacatccatcaccca
ctgtccacccacctgcctccggacacccgccgccgcaagacaccccagggccccggacgg
aagcctcgaaggcgtcccggagcctcacccactggggagacccctaccattgaggaggga
gaagaagatgaagatgaggccagtgaggctgagggtgcccgggcactgacccagcctacc
cctgcccctgtaccctcttccgtgcagttctttctccaggaagatgaaggcactgaccgg
aaggcagagaggaccagtccctctccccctccgccaccgccccatcaggaggcagctcct
cgggccaccaaaggggcccagactggagccatggtggaagaggtggtggcagtggccagc
ggcacagcaggaggtgatgatggcggtgcccctgggcgccccctgaccaaagcgcagcct
gggcaccgcagctacaacctgcaggagaggaggcgcatcggaagcatgaccggggccgag
caggcactgctgccccgggtccccacggacgagagtgaggcccagacgctggccacggct
gacctagatctcatgaaaagtcaccggtttgaggatgttcctggggttcggcggcacttg
gtacggaagaacgccaaagcgtctgggcagagtggccgggaaggacgcgatccgggcccc
accccgcggggccggccccgggccccgcacaagccccacgaggtgtttgtggagctgaat
gagttgctgctggacaaaaaccaggagccgcagtggagggagactgcccgctggatcaaa
ttcgaagaggacgtggaagaggagaccgagcgctgggggaagccccacgtggcttccctg
tccttccgcagcctcctggagctccgccggaccctagcccatggggccgtgctcttggac
ctggaccagcagaccctgcctggggtggcccaccaggtggtggagcagatggtcatctct
gaccagatcaaggcggaggacagagccaacgtgctgcgggccctgctcctgaaacacagc
cacccaagtgacgagaaggaattctccttcccccgaaatatctcggccggatccctgggc
tccctgctggggcatcaccatggccagggggccgagagcgacccccatgtcaccgagcct
ctcattggaggtgtcccggagaccaggttggaggtggagcgagagcgtgagcttccgcct
ccagccccgacggctggcatcactcgctctaagtccaagcacgagctgaagctgctggag
aagatccccgagaacgccgaggctacggtggtcctcgtgggctgcgtggagttcctctcc
cggcccaccatggccttcgtgcggctgcgggaggcagtggagctggacgcggtcctggag
gtgcccgtgcctgtgcgtttcctcttcctgctgctggggccgagcagcgccaacatggac
taccacgagatcggccgctccatctccaccctcatgtccgacaagcaattccatgaggca
gcctacctggcagacgagcgggaggacctcctgaccgccatcaacgccttcctggactgc
agtgtggtgctgccgccctcggaagtgcagggcgaggagctgcttcggtccgttgctcac
ttccagcgccagatgctcaagaagcgggaggagcagggccgcctcctgcccccaggggct
gggctggagcccaagtcagcccaagataaggcgctcctgcagatggtagaggcgacaggc
acagtggaagacgatccccttcggcggacaggccgtccctttggggggctcatccgagac
gtgcggcgccgctatccccactacctgagcgatttccgggatgcgctcgacccccagtgc
ctggccgcggtcatcttcatctactttgcagccctgtctcctgccatcaccttcggaggg
ctgctgggagagaagacgcaggacctgatcggggtgtcggagctgatcatgtccacggcg
ctccagggcgtgatcttctgcctgctgggcgcccagccgctgctggtgatcggcttctcc
gggcccctgctggtcttcgaggaggccttcttctcgttctgtaagagcaacaacctggag
tacctggtgggccgcgtgtggattggcttctggctggtgctgctggccctgctcatggtg
gccctggaggggagcttcctggtgcgttttgtctcccgtttcacccaggagatctttgcc
ttcctcatctccctcatcttcatctacgagaccttctacaagttgattaagatcttccag
gaacaccccctccatggctgttcggtctccaacagctccgaagcagacagtggagaggca
gacattggcgacaataccacgtgggctggggcaggagccacgctggggccagggaatggg
agctcgaccgggccccctgggcaggggaggccccagggccagcccaacacagccctgctg
tcgctggtgctcatggctggcaccttcttcatcgccttcttcctgcgcaaattcaagaac
agccggttcttccctggccgggtgcggcgggtgattggggactttggggtgcccatcgcg
atcctcatcatggtgcttgtggattacagtatcgaggacacctacacccagaagctgagt
gtgccagatggattctcagtgacagccccccaaaagcggggctgggtcatcaaccccctg
ggtgagaacagctccttccccgtgtggatgatggtggccagcctgctgcccgctatcctg
gtcttcattctcatcttcatggagacacagatcaccacgctgatcatctccaagaaggag
cgcatgctacagaagggctccggcttccacctggacctgctgctcatcgtggccatgggc
ggcatctgtgccctctttggcttgccctggttggctgctgccaccgtccgctccgtcact
cacgccaacgcgctcaccgtcatgagcaaggctgtggcacccggggacaagcccaagatc
caggaggtcaaggagcagcgggtgacagggctgttagttgccctgcttgtgggcctctcc
atggttatcggggacctgctccggcagatacccctggccgtgctcttcgggattttcctg
tacatgggtgttacctcccttaatgggatccagttctatgagaggctgcacctgctactc
atgccacccaaacaccacccagacgtcacctacgtgaagaaggtccggaccctgcgcatg
cacctgttcacagccctgcagctgctctgcctggccctgctctgggccgtcatgtccacg
gcggcctccctggccttccccttcattctcatcctcaccgtgccgctgcgcatggtggtg
ctcacccgcatcttcaccgagcgggagatgaaatgcctggacgccaacgaggcagagccc
gtgttcgatgagcgggagggtgtggacgagtacaacgagatgcccatgcctgtgtag

DBGET integrated database retrieval system