KEGG   Miniopterus natalensis: 107524933
Entry
107524933         CDS       T05883                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
mna  Miniopterus natalensis
Pathway
mna00220  Arginine biosynthesis
mna00330  Arginine and proline metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04066  HIF-1 signaling pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04611  Platelet activation
mna04915  Estrogen signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04931  Insulin resistance
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05415  Diabetic cardiomyopathy
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107524933 (NOS3)
   00330 Arginine and proline metabolism
    107524933 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107524933 (NOS3)
   04371 Apelin signaling pathway
    107524933 (NOS3)
   04066 HIF-1 signaling pathway
    107524933 (NOS3)
   04020 Calcium signaling pathway
    107524933 (NOS3)
   04071 Sphingolipid signaling pathway
    107524933 (NOS3)
   04022 cGMP-PKG signaling pathway
    107524933 (NOS3)
   04151 PI3K-Akt signaling pathway
    107524933 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107524933 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107524933 (NOS3)
   04921 Oxytocin signaling pathway
    107524933 (NOS3)
   04926 Relaxin signaling pathway
    107524933 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107524933 (NOS3)
   05418 Fluid shear stress and atherosclerosis
    107524933 (NOS3)
   05415 Diabetic cardiomyopathy
    107524933 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107524933 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107524933 (NOS3)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107524933 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 107524933
NCBI-ProteinID: XP_016052486
LinkDB
Position
Unknown
AA seq 1202 aa
MGNLKSVGQEPGPPCGLGLGLGLSLCGKQGPASPTPASEPSRTPAPTPLPAPDPSPPLTQ
PPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPCQGPPPAE
QLLSQAQDFINQYYSSIKRAGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCSSAQEMFTYICSHIKYATNRGNLRSAITVFPQRAPGRGDF
RIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFTVPPELVLEVPLEHPTLEWFASLGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTE
IGMRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDHH
AATSSFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQXDPWK
GSAAKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAGALMEMSGPYNSSP
RPEQHKSYKMRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKVFQATVLSVENLQSSKSTRATILV
RLDTGGLEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTFFLDITSPPSPRLLRLLSTLAEESSEQQELESLSQDPRRYE
EWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVLA
YRTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPF
RGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSREP
NSPKTYVQDVLRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHMRSAVPWAFDPPGADTP
GP
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgggccaggagcccgggccaccctgcggcctggggctgggg
ctgggcctcagcctgtgcggcaagcaaggcccggcctccccaacaccagcgtctgagccc
agccggacaccagcacccacacccctgcctgcaccagaccccagccccccgctgacccag
cccccggaggggcccaagttccctcgtgtgaagaactgggaggtggggagcattacctac
gacaccctcagtgcccaggcacagcaggatgggccctgcaccccacgacgctgcctgggc
tccctagtatttccaaggaaactgcagagccggccctgccagggccctccacccgccgag
cagctgttgagccaggcccaggacttcataaaccagtactacagttccatcaagagggct
ggctcccaagcccacgagcagcggctccaggaggtggaagccgaggtggcagccacgggc
acctaccagcttcgggagagcgagctggtgttcggggccaagcaggcctggcgcaacgcc
ccacgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggattgc
agctctgcacaggagatgttcacctacatctgtagccacatcaagtacgccaccaaccgg
ggcaacctgcgctccgccatcacagtgttcccccagcgcgccccgggccgcggggacttc
cgaatctggaacagccagctggtgcgctacgcgggctacaggcagcaggatggctccgtg
aggggggacccagccaacgtggagatcacggagctctgcatccagcacggctggacccca
ggcaacggccgcttcgacgtcctgcccctgctgctccaggcccccgacgaacctccggaa
ctcttcactgtgccccccgagctagtcctcgaggtgcctctggagcaccccacgctggag
tggttcgcctccctgggcctgcgctggtacgcgctcccggccgtgtccaacatgctgctg
gaaatcgggggcctggagttccccgcggcccctttcagcggctggtacatgagcacggag
atcggcatgcggaacctgtgtgacccgcaccgctacaacatcctggaggatgtggctgtc
tgcatggacctggatacccggacaacctcgtccctgtggaaggacaaagcagcagtggag
atcaacctggccgtgctgcacagttaccagctggccaaggtgaccatcgtggaccaccac
gcagccacctcctccttcatgaagcacctagagaacgagcagaaggccaggggcggctgt
cctgccgactgggcctggatcgtgccccccatctcgggcagcctcacccctgtcttccac
caggagatggtcaactacttcctgtcccctgccttccgctaccagncagacccctggaag
ggcagtgcagccaagggcgctggcatcaccaggaagaagacctttaaggaagtggccaat
gcagtgaagatctctgcctcgcttatgggcaccgtgatggccaagcgtgtgaaggcgacg
atcctgtacggctccgagaccggccgggcccagagctacgcgcagcagctggggaggctc
ttccggaaggctttcgacccccgggtcctgtgcatggacgagtatgacgtggtgtccctt
gagcatgagacgctggtgctggtggtgaccagcacgtttgggaatggggatcccccggag
aatggagagagtttcgcaggcgccctgatggagatgtccggaccctacaacagctccccg
aggccggaacagcacaagagttacaaaatgcgcttcaacagtgtttcctgctcggacccg
ctggtgtcctcctggcggcggaagaggaaggagtccagcaacacagacagtgcgggggca
ctgggcaccctcaggttctgcgtgtttgggctgggctcccgggcctacccccacttctgc
gcctttgcccgcgcggtggacacacggctggaagagctgggcggggagcggctcctgcag
ctgggccagggcgacgagctgtgcggccaggaggaggccttccgtggctgggcgcaggcc
gccttccaggcctcctgtgagaccttctgcgtgggggaggatgccaaggccgccgcccgg
gacatattcagccccaaaaggagctggaagcgccagaggtaccggctgagcacccaggcc
gagggcctccagctgctgccaggcctgatccacgtgcacaggagaaaggtgttccaggcc
actgtcctctccgtggagaacctgcagagcagcaagtccacccgggccactatcctggtg
cgcctggacaccggaggcctggaggggctccagtaccagccaggggaccacataggcgtc
tgcccgcccaatcggccgggcctcgtggaggcgctgctgagccgtgtggaggacccgccg
ccacctggcgagcccgtggcagtggagcagctggagaagggcagccctggtggccctccc
ccaggctgggtgcgggacccccggctgcccccctgcacactgcgccaggctctcaccttc
ttcctggacatcacgtccccacccagccctcgactcctccgactgctcagcaccctggct
gaagagtccagcgaacagcaggagcttgagagccttagccaggacccccggcgctacgag
gagtggaagtggttccgctgccccacgctgctggaggtgctggagcagtttccgtcggtc
gctctgcccgcccccctgctcctcactcagctgcccctgctccagccccggtactactca
gtcagctcagcacccagcacccacccaggggagatccacctcacagtggccgtgctggca
tacaggacccaggatgggctgggtcccctgcactacggagtctgctctacatggctgagc
caactcaaggctggagaccctgtgccctgcttcatcaggggggctccctccttccggcta
ccacctgaccccagcttgccctgtatcctggtgggcccgggcactggcatcgcccccttc
agaggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccgcgccc
atgaccttggtattcggctgccgatgctcccagctggaccacctctaccgcgacgaggtg
caggacgcccagcagcgcggcgtgtttggccgagtcctcactgccttctcccgagaaccc
aacagccctaagacctacgtgcaggacgtcctgcggacggagctggccgccgaggtgcac
cgcgtgctgtgcctcgaacggggccacatgtttgtctgcggcgatgtcaccatggcaacc
agcgtcctgcagacggtgcagcgcatcctggcgacagagggcgacatggagctggacgag
gccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggacattttcggg
ctcacgctgcgcacccaggaggtgacaagccgcatccgcacccagagcttctccttgcag
gagcggcatatgcgcagcgcagtgccctgggctttcgacccgccgggcgcagacaccccc
gggccctga

DBGET integrated database retrieval system