KEGG   Miniopterus natalensis: 107524933
Entry
107524933         CDS       T05883                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
mna  Miniopterus natalensis
Pathway
mna00220  Arginine biosynthesis
mna00330  Arginine and proline metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04066  HIF-1 signaling pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04611  Platelet activation
mna04915  Estrogen signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04931  Insulin resistance
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107524933 (NOS3)
   00330 Arginine and proline metabolism
    107524933 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107524933 (NOS3)
   04371 Apelin signaling pathway
    107524933 (NOS3)
   04066 HIF-1 signaling pathway
    107524933 (NOS3)
   04020 Calcium signaling pathway
    107524933 (NOS3)
   04071 Sphingolipid signaling pathway
    107524933 (NOS3)
   04022 cGMP-PKG signaling pathway
    107524933 (NOS3)
   04151 PI3K-Akt signaling pathway
    107524933 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107524933 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107524933 (NOS3)
   04921 Oxytocin signaling pathway
    107524933 (NOS3)
   04926 Relaxin signaling pathway
    107524933 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107524933 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107524933 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107524933 (NOS3)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107524933 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 107524933
NCBI-ProteinID: XP_016052486
LinkDB
Position
Unknown
AA seq 1202 aa
MGNLKSVGQEPGPPCGLGLGLGLSLCGKQGPASPTPASEPSRTPAPTPLPAPDPSPPLTQ
PPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPCQGPPPAE
QLLSQAQDFINQYYSSIKRAGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCSSAQEMFTYICSHIKYATNRGNLRSAITVFPQRAPGRGDF
RIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFTVPPELVLEVPLEHPTLEWFASLGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTE
IGMRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDHH
AATSSFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQXDPWK
GSAAKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAGALMEMSGPYNSSP
RPEQHKSYKMRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKVFQATVLSVENLQSSKSTRATILV
RLDTGGLEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTFFLDITSPPSPRLLRLLSTLAEESSEQQELESLSQDPRRYE
EWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVLA
YRTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPF
RGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSREP
NSPKTYVQDVLRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHMRSAVPWAFDPPGADTP
GP
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgggccaggagcccgggccaccctgcggcctggggctgggg
ctgggcctcagcctgtgcggcaagcaaggcccggcctccccaacaccagcgtctgagccc
agccggacaccagcacccacacccctgcctgcaccagaccccagccccccgctgacccag
cccccggaggggcccaagttccctcgtgtgaagaactgggaggtggggagcattacctac
gacaccctcagtgcccaggcacagcaggatgggccctgcaccccacgacgctgcctgggc
tccctagtatttccaaggaaactgcagagccggccctgccagggccctccacccgccgag
cagctgttgagccaggcccaggacttcataaaccagtactacagttccatcaagagggct
ggctcccaagcccacgagcagcggctccaggaggtggaagccgaggtggcagccacgggc
acctaccagcttcgggagagcgagctggtgttcggggccaagcaggcctggcgcaacgcc
ccacgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggattgc
agctctgcacaggagatgttcacctacatctgtagccacatcaagtacgccaccaaccgg
ggcaacctgcgctccgccatcacagtgttcccccagcgcgccccgggccgcggggacttc
cgaatctggaacagccagctggtgcgctacgcgggctacaggcagcaggatggctccgtg
aggggggacccagccaacgtggagatcacggagctctgcatccagcacggctggacccca
ggcaacggccgcttcgacgtcctgcccctgctgctccaggcccccgacgaacctccggaa
ctcttcactgtgccccccgagctagtcctcgaggtgcctctggagcaccccacgctggag
tggttcgcctccctgggcctgcgctggtacgcgctcccggccgtgtccaacatgctgctg
gaaatcgggggcctggagttccccgcggcccctttcagcggctggtacatgagcacggag
atcggcatgcggaacctgtgtgacccgcaccgctacaacatcctggaggatgtggctgtc
tgcatggacctggatacccggacaacctcgtccctgtggaaggacaaagcagcagtggag
atcaacctggccgtgctgcacagttaccagctggccaaggtgaccatcgtggaccaccac
gcagccacctcctccttcatgaagcacctagagaacgagcagaaggccaggggcggctgt
cctgccgactgggcctggatcgtgccccccatctcgggcagcctcacccctgtcttccac
caggagatggtcaactacttcctgtcccctgccttccgctaccagncagacccctggaag
ggcagtgcagccaagggcgctggcatcaccaggaagaagacctttaaggaagtggccaat
gcagtgaagatctctgcctcgcttatgggcaccgtgatggccaagcgtgtgaaggcgacg
atcctgtacggctccgagaccggccgggcccagagctacgcgcagcagctggggaggctc
ttccggaaggctttcgacccccgggtcctgtgcatggacgagtatgacgtggtgtccctt
gagcatgagacgctggtgctggtggtgaccagcacgtttgggaatggggatcccccggag
aatggagagagtttcgcaggcgccctgatggagatgtccggaccctacaacagctccccg
aggccggaacagcacaagagttacaaaatgcgcttcaacagtgtttcctgctcggacccg
ctggtgtcctcctggcggcggaagaggaaggagtccagcaacacagacagtgcgggggca
ctgggcaccctcaggttctgcgtgtttgggctgggctcccgggcctacccccacttctgc
gcctttgcccgcgcggtggacacacggctggaagagctgggcggggagcggctcctgcag
ctgggccagggcgacgagctgtgcggccaggaggaggccttccgtggctgggcgcaggcc
gccttccaggcctcctgtgagaccttctgcgtgggggaggatgccaaggccgccgcccgg
gacatattcagccccaaaaggagctggaagcgccagaggtaccggctgagcacccaggcc
gagggcctccagctgctgccaggcctgatccacgtgcacaggagaaaggtgttccaggcc
actgtcctctccgtggagaacctgcagagcagcaagtccacccgggccactatcctggtg
cgcctggacaccggaggcctggaggggctccagtaccagccaggggaccacataggcgtc
tgcccgcccaatcggccgggcctcgtggaggcgctgctgagccgtgtggaggacccgccg
ccacctggcgagcccgtggcagtggagcagctggagaagggcagccctggtggccctccc
ccaggctgggtgcgggacccccggctgcccccctgcacactgcgccaggctctcaccttc
ttcctggacatcacgtccccacccagccctcgactcctccgactgctcagcaccctggct
gaagagtccagcgaacagcaggagcttgagagccttagccaggacccccggcgctacgag
gagtggaagtggttccgctgccccacgctgctggaggtgctggagcagtttccgtcggtc
gctctgcccgcccccctgctcctcactcagctgcccctgctccagccccggtactactca
gtcagctcagcacccagcacccacccaggggagatccacctcacagtggccgtgctggca
tacaggacccaggatgggctgggtcccctgcactacggagtctgctctacatggctgagc
caactcaaggctggagaccctgtgccctgcttcatcaggggggctccctccttccggcta
ccacctgaccccagcttgccctgtatcctggtgggcccgggcactggcatcgcccccttc
agaggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccgcgccc
atgaccttggtattcggctgccgatgctcccagctggaccacctctaccgcgacgaggtg
caggacgcccagcagcgcggcgtgtttggccgagtcctcactgccttctcccgagaaccc
aacagccctaagacctacgtgcaggacgtcctgcggacggagctggccgccgaggtgcac
cgcgtgctgtgcctcgaacggggccacatgtttgtctgcggcgatgtcaccatggcaacc
agcgtcctgcagacggtgcagcgcatcctggcgacagagggcgacatggagctggacgag
gccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggacattttcggg
ctcacgctgcgcacccaggaggtgacaagccgcatccgcacccagagcttctccttgcag
gagcggcatatgcgcagcgcagtgccctgggctttcgacccgccgggcgcagacaccccc
gggccctga

KEGG   Miniopterus natalensis: 107528483
Entry
107528483         CDS       T05883                                 

Gene name
NOS1
Definition
(RefSeq) nitric oxide synthase, brain
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
mna  Miniopterus natalensis
Pathway
mna00220  Arginine biosynthesis
mna00330  Arginine and proline metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04145  Phagosome
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04730  Long-term depression
mna04926  Relaxin signaling pathway
mna04970  Salivary secretion
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107528483 (NOS1)
   00330 Arginine and proline metabolism
    107528483 (NOS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107528483 (NOS1)
   04020 Calcium signaling pathway
    107528483 (NOS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107528483 (NOS1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107528483 (NOS1)
  09154 Digestive system
   04970 Salivary secretion
    107528483 (NOS1)
  09156 Nervous system
   04730 Long-term depression
    107528483 (NOS1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107528483 (NOS1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528483 (NOS1)
   05014 Amyotrophic lateral sclerosis
    107528483 (NOS1)
   05022 Pathways of neurodegeneration - multiple diseases
    107528483 (NOS1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107528483 (NOS1)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_6 PDZ_2 Flavodoxin_5
Other DBs
NCBI-GeneID: 107528483
NCBI-ProteinID: XP_016057052
LinkDB
Position
Unknown
AA seq 1434 aa
MENHMFSVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGQPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTRPLGPPTTAVDLSHQSSACKEQALAVDGATGPGNGPQHGLDNGPEAGSLAHANGLAP
RPPGQAPAKKNPGIALQGSGEHNELLKEIQPVLNLLTTGDKGINGGAPAKAETKDVEVQV
DRDVDSKSHKPLPLGVENDHVVNDLWGTGSVPVVLNNPYSEKEQPPASGRQSPTKNGSPS
KCPRFLKVKNWETDVVLTDTLHLKSTLETGCSEHICMGSIMHTSQQIRRPEDVRTKEQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIETTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHIKYATNKGNLRSAITIFPQRIDSKHDFRVW
NSQLIRYAGYKQPDGSILGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKFEWFRDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
WKGSNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRQPNSVH
EERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMGEGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTYVAEAPELAQGLSSVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDSPPVNQLVKVELLEERNTALGV
ISNWTDEHRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY
EEWKWGKNPTIVEVLEEFRSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
SYSTRDGDGPVHHGVCSSWLNRIQAAEVVPCFVRGAPSFHLPQNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHRGMSPCPMILVFGCRQSKIDHIYREETLQARNTGVFRELYTAYSRE
PDKPKKYVQDILQEKLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMAQQGKLSVE
DAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
NT seq 4305 nt   +upstreamnt  +downstreamnt
atggagaatcacatgttcagtgttcagcagatccaacccaacgtgatttctgtccgcctc
ttcaagcgcaaagtggggggcctggggttcctggtgaaggagcgagtgagcaagcccccc
gtgatcatctccgacctgattcgagggggcgccgcagagcagagtggcctcatccaggcc
ggggacatcatcctcgcggtcaatggccagcccctggtggacctgagttatgacagcgcc
ctggaggtgctcaggggcattgcctccgagacccacgtggtcctcattctgaggggcccc
gagggcttcaccacgcacctggagaccaccttcactggggacgggacccccaagaccatc
cgggtgacacggcccctgggtccccccaccacagccgtcgatctgtcacaccagtcgtca
gcctgcaaagagcaggcgctggcagtggacggggccaccggtcccggcaatgggccacag
catggcctcgacaatggaccggaagctggctcgctggctcacgctaatggcctggccccc
aggcccccgggccaggcccccgccaagaagaatcctgggattgcccttcagggcagcggg
gagcacaatgaactcctcaaagagatccagcctgtcctgaaccttctcaccactggtgac
aaaggcatcaatggaggggcaccggccaaggcggagacaaaggacgtggaagtccaggtg
gacagagacgtggacagcaagtcacacaagcctctgccccttggcgtggagaatgaccac
gtcgtcaatgacctgtgggggacgggcagtgtgcccgtggtcctcaacaacccgtattcc
gagaaggagcagccccctgcctcgggacgacagtcccccacgaagaatggcagcccctcc
aagtgcccccgcttcctcaaggtcaagaactgggagacggacgtggttctcacggacacc
ctccaccttaagagtaccctggaaacgggatgcagtgagcacatctgcatggggtccatc
atgcacacttcccagcaaatccggaggcctgaagatgtccgcacgaaagagcagctcttc
cctcttgccaaagagttcattgatcagtactactcgtcaattaaaagatttggctccaaa
gcccacatggagaggctggaagaggtgaacaaagagattgaaaccaccagcacctaccag
ctcaaagacactgagctcatctacggggccaagcacgcctggaggaatgcctcccgctgc
gtcggcaggatccagtggtccaagctgcaggtgttcgatgcccgcgactgcaccacggcc
cacgggatgttcaactacatttgcaaccacatcaagtatgccaccaacaaagggaacctc
aggtctgccatcaccatatttccgcagaggatcgacagcaagcacgatttccgagtctgg
aactcccagctcatccgctatgccggctacaagcagcccgacggctccatcctgggagac
ccagccaatgtgcagttcacagagatctgcatacagcaaggctggaaacccccgagaggt
cgcttcgatgtcctgccgctcctgctccaggccaacggcaatgaccccgagctcttccag
attcctccagagctggtgttagaagtgcccatcaggcaccccaagtttgaatggttcagg
gacctggggctgaagtggtacggcctccccgctgtgtccaatatgcttctggagattggt
ggcctggagttcagcgcctgtcccttcagcggctggtacatgggcacggagattggcgtc
cgtgactactgtgacaactctcggtacaacatcctggaggaagtggccaagaagatgaac
ttggacatgaggaagacgtcttccctgtggaaggaccaggcgctggtggagatcaacatc
gcggtcctctacagcttccagagtgacaaagtgaccatcgtcgaccaccactcggccacc
gagtccttcattaaacacatggaaaatgaataccgctgccgggggggctgcccggccgac
tgggtgtggatcgtgccccccatgtctggcagcatcaccccggtcttccaccaggagatg
ctcaactaccggctcaccccgtccttcgaataccagcctgacccttggaacacccatgtc
tggaaaggcagcaacgggacccccacaaagcgacgagccatcggcttcaagaagctggca
gaagccgtcaagttctcggccaagctgatggggcaggcaatggccaagagggtcaaggcg
accatcctttatgccacagagacgggcaaatcacaggcctatgccaaaaccttgtgtgag
atcttcaagcacgcctttgatgccaaggtgatgtccatggaagaatacgacattgtgcac
ctggaacatgagactctggtcctggtggtcaccagcacctttggcaacggagacccccct
gagaacggagagaaattcggctgcgctctgatggaaatgaggcaacccaactctgtgcac
gaggaaaggaagagctacaaggtcaggttcaatagtgtttcctcctattccgactcccgc
aaatcatcaggcgacgggccggacctcagagacaacttcgagagcgctggccccctggca
aatgtgaggttctcggtgtttggccttggctctcgggcttacccccacttctgcgccttt
ggacatgccgtggatacgctcctggaagagttgggaggagagaggatcctgaagatgggg
gagggggatgagctctgtgggcaggaggaggctttcaggacctgggccaagaaggtcttc
aaggcagcctgtgatgtgttctgcgtgggagatgacgtcaacatcgagaaggcgaacaac
tccctcatcagcaacgaccgcagctggaagaggaacaagttccgcctcacctatgtggcc
gaagctccggagctcgcccaaggtctgtccagtgtccacaaaaagcgggtctcagccgct
cggctgctcagccgtcaaaaccttcagagccctaagtccagccgatcaaccatcttcgtg
cgtctccacaccaacgggaaccaggagctgcagtaccagcctggggaccacctgggcgtc
ttccccggcaaccacgaggacctcgtgaatgcccttatcgagcggctggaggactcaccc
cctgtcaaccagctggtgaaagtggagctgctggaagagcggaacacggccttgggagtt
atcagcaactggacggatgagcaccgcctgccgccctgcaccatcttccaggccttcaag
tactacctggacatcaccactccgcccacgccgctgcagctgcagcagtttgcctccctg
gccaccagcgagaaagagaagcagcgtctgctggtcctcagcaagggattgcaggagtac
gaggaatggaaatggggcaagaatcccaccattgtggaggtgctggaggagttccggtcc
atccagatgcctgccaccctgctcctgacccagctgtcgctcctgcagcctcgttactat
tccatcagctcctccccggacatgtaccccgatgaggtgcacctcaccgtggctatcgtc
tcctactccacccgagatggagacggaccagttcaccacggggtgtgctcctcctggctc
aaccggatacaggctgccgaggtggtcccctgtttcgtgagaggggctcccagcttccac
cttccccaaaatccccaagtgccctgcatcctggttggcccgggcaccggcatcgcccct
ttccgaagcttctggcagcagcggcaatttgatatccaacacagaggcatgagcccctgc
cccatgatcctggtcttcgggtgccggcagtccaagatagaccacatctacagggaggag
accctgcaggccaggaacacgggcgtcttcagagagctgtacacggcctactcccgggag
ccagacaaaccaaagaagtacgtgcaggacatcctgcaagagaagctggcggaatccgtg
taccgagccctgaaggagcaagggggccacatttacgtctgtggggacgtcaccatggcc
gccgatgtcctcaaagccatccagcgcatcatggcccagcaggggaaactctccgtggag
gacgccggcgtgttcatcagccggctgagggatgacaaccgctaccatgaggatattttc
ggggtcaccctgcgaacgtatgaagtgaccaaccgccttagatctgaatccattgccttc
atcgaagagagcaaaaaagacactgatgaggtttttagctcctaa

KEGG   Miniopterus natalensis: 107533063
Entry
107533063         CDS       T05883                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mna  Miniopterus natalensis
Pathway
mna00220  Arginine biosynthesis
mna00330  Arginine and proline metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04066  HIF-1 signaling pathway
mna04146  Peroxisome
mna04371  Apelin signaling pathway
mna04926  Relaxin signaling pathway
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05133  Pertussis
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05200  Pathways in cancer
mna05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107533063 (NOS2)
   00330 Arginine and proline metabolism
    107533063 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107533063 (NOS2)
   04066 HIF-1 signaling pathway
    107533063 (NOS2)
   04020 Calcium signaling pathway
    107533063 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107533063 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107533063 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533063 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107533063 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107533063 (NOS2)
   05014 Amyotrophic lateral sclerosis
    107533063 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    107533063 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107533063 (NOS2)
   05152 Tuberculosis
    107533063 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107533063 (NOS2)
   05145 Toxoplasmosis
    107533063 (NOS2)
   05140 Leishmaniasis
    107533063 (NOS2)
   05142 Chagas disease
    107533063 (NOS2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107533063 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 107533063
NCBI-ProteinID: XP_016063124
LinkDB
Position
Unknown
AA seq 1139 aa
MKEPDINNNTDKTMRVPYSAVTQDDPKCHSLGKHRNESPQPFTGTGKKSPESLVKLDAPP
SACPQHVRIKNWGSGMTFQDTLHHKAKGDLACKSKCCLGAIMNSKSLTRGPRDRPTSPDE
LLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIYATKQAWRNAP
RCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNIRSAITVFPQRSDGKHDFR
VWNAQLIRYAGYQMPDGTIRGDPACLEFTQLCIDLGWKPKYGRFDVVPLVLQAGGRDPEL
FEIPPDLVLEVPMEHPKYEWFRELGLKWYTLPAVSNMLLEVGGLEFPGCPFNGWYMGTEI
GVRDFCDAQRYNILEEVGRRMGLETHKLASLWKDQAVIEINVAVLHSFQKQNVTIMDHHS
AAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEMLNYVLSPFYYYQVEAWKT
HVWQDEKRRPQRRVIRFQVLAKAVLFASMLIRKTMASRVRATILFATETGRSETLARDLG
ALFSCAFNPKVLCMDEYRLSSLEEERLLLVVTSTFGNGDSPGNGEKLKKSLFMLKKLTNK
FRYAVFGLGSSMYPQFCAFAHDVDQKLSHLGASQLTPTGEGDELSGQEEAFRSWAVQTFK
AACEAFDVRGKHCIQIPKLYTTSVTWDPRHYRLVQDSQPLDLNKALSSMHAKNVFTMKLK
SRQNLQSPKSSRSTLLVELSSEGSQGLSYLPGEHLGVFPSNQPALVQGILERVVDNPAPH
QPVCLETLSETGSYWVRDKRLPPCSLSQALTYFLDITTPPTQLLLRKLAQLASEEAERQR
LETLCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQLPVLKPRYYSISSSRDCTP
TEIHLTVAVLTYHTRDGQGPLHHGVCSTWLSSLEPQDPVPCFVRSASGFQLPENTSHPCI
LIGPGTGIAPFRSFWQQRLHDAEHKGLQCGHMTLVFGCRRPDEDHLYREEMLEMARRGVL
HAVHTAYSRLPGQPKVYVQDILQQKLATEVLHVLHKEQGHLYVCGDAHMARDVAHTLKQL
VAAKLSLSEEQVEDYFFQLKSQKRYHEDIFSAVFPYKVKRDGAAGQPSDPRAPAAHRRS
NT seq 3420 nt   +upstreamnt  +downstreamnt
atgaaggaaccagacatcaacaacaatacagacaaaaccatgcgggttccctacagtgca
gtgacacaggatgaccccaagtgtcacagccttggcaagcaccggaatgagtccccccag
cccttcacggggacaggaaagaagtctccagaatccctggtcaagctggatgcaccccca
tcagcctgcccacagcatgtgaggatcaaaaactggggcagtggaatgactttccaagac
acacttcaccacaaggccaaaggggacttggcttgcaaatctaagtgttgcttgggagcc
atcatgaactccaaaagtttgaccagaggacccagggacaggcctacctctccagatgag
cttctacctcaagctatcgaatttgtcaaccagtattacagctccttcaaagaggcaaaa
atagaggaacatctggccagggtggaagctgtaacaaaggagatagaaacaacaggaacc
taccagctgacgggagatgagctcatctacgccaccaagcaggcctggcgcaatgccccg
cgctgcatcgggaggatccagtggtccaacctgcaggtctttgatgcccggagctgttcc
actgcccaggaaatgttcgagcacatctgccgacacctgcgatatgccaccaacaatggc
aacatcaggtcggccatcaccgtgttcccccagcggagcgatgggaagcatgacttccga
gtctggaacgcacagctcatccgctacgccggctaccagatgcctgatggcaccatcaga
ggggaccctgcctgcctggagttcacccagctgtgcatcgacctgggctggaaacccaag
tatggccgcttcgacgtggtgcctctggtcctgcaggctggtggccgcgaccctgagctc
tttgaaatcccgcctgaccttgtgctcgaggtgcctatggaacatcccaagtatgagtgg
ttccgggagctggggctgaagtggtacaccctgcctgcagtgtccaacatgctgctcgag
gtgggtggcctcgagttcccagggtgccccttcaacggctggtacatgggcacagagatt
ggggtccgggacttctgtgatgctcagcgctacaacatcctggaggaagtgggcaggagg
atgggcctggaaacgcacaagttggcctcactctggaaggaccaggctgtcattgagatc
aatgtcgctgtgctccacagtttccagaagcaaaatgtgaccatcatggatcaccactca
gctgcggagtccttcatgaagtacatgcagaatgagtaccggtcccgagggggctgccct
gccgactggatctggctggtgcccccgatttctggaagcatcacccccgtgttccaccag
gagatgttgaactatgttctgtcccccttctactactaccaggtggaggcctggaaaacc
cacgtctggcaggacgagaagaggagaccccagagaagagtgattcgattccaagtcttg
gctaaagccgtgctcttcgcctctatgctgatacgcaagaccatggcgtcccgggtcaga
gccaccatcctctttgcgacggagacgggaagatcagaaacgctggcccgggacctcggg
gccctgttcagctgtgccttcaaccccaaggttctctgcatggacgagtacaggctaagc
agcctggaggaggagcggctgctgctggtggtgaccagcacgtttgggaacggagactcc
cccggcaatggagagaaactgaagaaatctctcttcatgctgaaaaagctcaccaacaag
ttcaggtatgccgtgttcggcctcggctccagcatgtaccctcagttctgcgcctttgct
cacgatgtcgaccagaagttgtcccacctgggagcgtctcagctcaccccgacaggggaa
ggagatgagctcagtgggcaggaagaggccttccgcagctgggctgtgcaaaccttcaag
gcagcctgtgaggcattcgatgtccgaggcaaacactgcattcagatccccaagctctac
accaccagtgtgacctgggacccgcgccactacaggctcgtgcaggactctcagcctctg
gacctcaacaaagccctcagcagcatgcacgccaagaacgtgttcaccatgaagctcaaa
tcgcggcagaatctacagagtccgaaatccagccgctccaccctcctggtggagctctcc
agcgagggcagccaaggtctcagctacctgccgggagagcacctgggggttttcccaagc
aaccagccggccctggtgcaaggcattttggagcgagtggtggacaaccccgcaccccac
caacccgtgtgcctggagaccctcagtgagaccggcagctactgggtcagggacaagcgg
ctgcccccctgctcactcagccaggccctcacctacttcctggacatcaccacaccccca
acccagctgctgctccgaaagctggcccagctggcttcagaagaggccgagaggcagagg
ctagagaccctgtgccagccctcagagtacaacaagtggaagttcaccaacagccccaca
ttcctggaggtgctggaggagttcccgtccctgcgggtatctgccagcttcctgctttcc
cagctccctgtcctgaaaccccgatactactccatcagctcctccagggactgcaccccc
acagagatccacctcaccgtggccgtgctcacctaccacacccgagatggccagggcccc
ctgcaccacggtgtctgcagcacatggctcagcagcctggagccccaagacccagtgccc
tgttttgtacgaagtgccagcggcttccagctccccgagaacacctcccacccttgcatc
ctcattgggcctggcactggcatcgctcccttccgcagtttctggcagcagcgtctccat
gatgccgagcacaaagggctccagtgtggccacatgaccctggtgttcgggtgccggcgc
ccagacgaggaccacctctatcgggaggagatgctggagatggcccggagaggggtgctg
cacgcggtgcacacagcctactcgcgcctgcctggccagcccaaggtctacgttcaagac
atccttcagcagaagctggccaccgaggtgctccacgtgctccacaaggagcaaggccac
ctctatgtctgtggggatgcgcacatggcccgggatgtggcccacacactgaagcagctg
gtggctgccaagctgagcctgagtgaggagcaggtcgaggactatttcttccagcttaag
agccagaagcgctaccatgaagatatcttcagtgctgtgtttccctacaaggtgaaaaga
gatggggcagcgggacagcctagcgatccccgagctccagcagcccacaggagaagttaa

DBGET integrated database retrieval system