KEGG   Miniopterus natalensis: 107524984
Entry
107524984         CDS       T05883                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04064  NF-kappa B signaling pathway
mna04120  Ubiquitin mediated proteolysis
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04510  Focal adhesion
mna04621  NOD-like receptor signaling pathway
mna05145  Toxoplasmosis
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107524984 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107524984 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107524984 (XIAP)
   04215 Apoptosis - multiple species
    107524984 (XIAP)
   04217 Necroptosis
    107524984 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107524984 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107524984 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107524984 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107524984 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107524984 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107524984 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107524984 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107524984 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107524984 (XIAP)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107524984 (XIAP)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107524984 (XIAP)
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I32: IAP family
   107524984 (XIAP)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107524984 (XIAP)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    107524984 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 DUF2039
Other DBs
NCBI-GeneID: 107524984
NCBI-ProteinID: XP_016052544
LinkDB
Position
Unknown
AA seq 497 aa
MTFNCFGGSKTCVPADTDKDEEFVEELNRLKTFANFPSSSPVSASTLARAGFLYTGKGDT
VQCFSCRAAVDRWQYGDSAVGRHRKVSPNCQFISGFYFENSAAQSTSSRILNGSYKGENY
LGNRHHFALDRPSETHADYLLRTGQVVDLSDTIYPRNPAMCSEEARLQSFQNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNINTRSE
SDALGSDRNFPNSTNPPRNPAMADYEARIITFGTWMYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEEHAKWYPGCKYLLEEKGQEYINNIHLTHSLEDSVARTAEKTP
SVTKRIDDNISQSPMIHEAMRMGFSFGDIKKKMEEKIQTSGSNYKSLEVLVADLVSAQKD
STQDESSQTSLQKDISAEEQLRLLQEEKLCKICMDRNIAVAFIPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFIS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacttttaactgttttggaggatctaaaacttgtgtacctgcagacaccgataaagat
gaagaatttgtagaagagcttaatagattaaaaacttttgctaattttccaagtagtagt
cctgtttcggcatcaacactagcacgagctggttttctatatactggcaaaggcgacacg
gtgcagtgctttagttgtcgcgcagcagtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgccaatttatcagtggcttttattttgaaaat
agtgctgcgcaatctacaagttctcgtatcctgaatggttcgtacaaaggtgaaaattat
ctgggaaacagacatcattttgctttagacaggccatccgagactcacgcagactatctt
ttgagaactggacaggttgtagatctctccgacaccatatacccgaggaaccctgccatg
tgtagtgaagaagctcgattacagtcatttcagaattggccagactatgcccacttaacc
cccagagagttagctagtgctgggctctactatacaggtattgacgatcaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgtgatcgtgcatggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccggaatattaatactcgaagtgaa
tctgatgccctgggttctgataggaatttcccaaattcaacaaatcctccaagaaatcca
gccatggcagattacgaagcacggatcattacttttgggacgtggatgtactctgttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgc
tttcattgtggaggagggctgactgattggaaacccagtgaagacccttgggaagaacat
gctaagtggtatccagggtgtaaatatctgttggaagagaaaggacaagaatatataaac
aatattcatttaactcattcacttgaggactcagtggcaagaactgctgaaaaaacacca
tcagtaactaaaagaattgatgataacatctctcagagtcctatgatacatgaagctatg
cgaatgggattcagtttcggggacattaagaaaaaaatggaggaaaaaatccagacatct
gggagcaactataagtcactggaggttctggttgcagatctagtgagcgctcagaaagac
agtacacaagatgagtcaagtcagacttcattgcagaaagacattagtgctgaagagcag
ctaaggctcctgcaagaggagaagctttgcaagatctgcatggatagaaatattgctgtc
gcatttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgataaa
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatatcttaa

KEGG   Miniopterus natalensis: 107532046
Entry
107532046         CDS       T05883                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04390  Hippo signaling pathway
mna05161  Hepatitis B
mna05200  Pathways in cancer
mna05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107532046 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107532046 (BIRC5)
   04215 Apoptosis - multiple species
    107532046 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532046 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107532046 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107532046 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107532046 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107532046 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107532046 (BIRC5)
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I32: IAP family
   107532046 (BIRC5)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     107532046 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107532046 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 107532046
NCBI-ProteinID: XP_016061779
LinkDB
Position
Unknown
AA seq 142 aa
MGAPSLPAAWQLYLKDHRVSTFKNWPFLEGCACTPERMAAAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPVEEHKKHSSGCAFLSVKKQFEDLTLGEFLKLDKERAKNKIAKEAHSK
QKEFEETAKEARCAIEQLAAAE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtgccccgtcgttgcccgcggcctggcagctctacctaaaggaccaccgcgtctcc
acgttcaagaactggcccttcctggagggctgcgcatgcaccccggagcggatggccgcg
gccggcttcatccactgccccaccgagaacgagcccgacttggcccagtgcttcttctgc
ttcaaggagctggagggctgggagccggacgacgaccccgtagaggagcataaaaagcac
tcgtctggttgtgctttcctttctgtgaagaagcagtttgaagacttaaccctcggtgaa
tttttgaaactggacaaagaaagagccaagaacaaaattgcaaaggaagcccacagtaag
cagaaggagtttgaagagactgcaaaggaggcgcgctgtgccattgagcagctggcggcc
gctgagtga

KEGG   Miniopterus natalensis: 107532417
Entry
107532417         CDS       T05883                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04064  NF-kappa B signaling pathway
mna04120  Ubiquitin mediated proteolysis
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04621  NOD-like receptor signaling pathway
mna04668  TNF signaling pathway
mna05132  Salmonella infection
mna05145  Toxoplasmosis
mna05168  Herpes simplex virus 1 infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107532417 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107532417 (BIRC2)
   04064 NF-kappa B signaling pathway
    107532417 (BIRC2)
   04668 TNF signaling pathway
    107532417 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107532417 (BIRC2)
   04215 Apoptosis - multiple species
    107532417 (BIRC2)
   04217 Necroptosis
    107532417 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107532417 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107532417 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532417 (BIRC2)
   05202 Transcriptional misregulation in cancer
    107532417 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107532417 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107532417 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107532417 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107532417 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107532417 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107532417 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107532417 (BIRC2)
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I32: IAP family
   107532417 (BIRC2)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107532417 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 107532417
NCBI-ProteinID: XP_016062235
LinkDB
Position
Unknown
AA seq 598 aa
MEDSTILSNWKIDSKHTMKYDFSCELYRMSTYSTFPTGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDNPVEKHKQLYPSCSFIQNLVSVTSLESTFKNTSPMRNNFTHSLS
PTLEQSGSFSGSYPNLLPNPVHSRAVEDFSPLRTNPYSYAMSTEQARLLTYNLWPLTFLS
PSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFS
ISNLSMQTHAARLRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGD
DPWVEHAKWFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTAADENADPPIVHFGP
GESSSEDAVMMNTPVVKAALEMGFSRSLVKQTVQSKILTTGENYKTVNDIVSALLNAEDE
NRQEEKERQTEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANIINKQEHDIIKQKT
QIPLQARELIDTVLVKGNAAANIFKNCLKEIDSTLYKNLFVEKNMKYIPSEDVSGLSLEE
QLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggaagatagcacgattttgtcaaattggaaaattgacagcaaacacacaatgaaatat
gacttttcatgtgaactctacagaatgtctacatattcaactttccccacgggtgttcct
gtgtcagaaaggagtcttgcacgtgctggtttttattacactggtgtgaatgacaaagtc
aaatgcttctgttgtggcctgatgctggataactggaaacaaggagacaaccctgttgaa
aagcataaacagctctatcctagctgtagctttattcagaatctggtttctgttactagt
ttggaatccacctttaagaatacttctccaatgaggaacaattttacacactcattatct
cccactttggagcaaagtggctcattcagtggttcttatcccaaccttttaccaaaccct
gttcattctagagcagttgaagacttctccccattgaggactaacccctacagttatgca
atgagcacagaacaagccagattgctcacttacaacctgtggccattaacctttttgtca
ccatcagaattggcaagagctggtttttattacataggacctggagatagggtagcctgc
tttgcttgcggtgggaaactaagtaactgggagccaaaggacgatgctatgtcagaacac
cggagacatttcccaaactgtccatttttggagaattctctagaaacgctgaggtttagc
atttcaaatttgagcatgcagacacatgcagcccgactgagaacatttatgtactggcca
tctagtgttccagttcaacctgagcagcttgcaagtgctggtttctattatgtgggtcgc
aatgatgatgtcaaatgcttttgttgtgatggtggcttaaggtgttgggaatctggagat
gacccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgcatgaaa
ggacaggagtttgttgatgaaattcaagccagatatcctcatcttcttgaacagctgttg
tcaacttcagacactgctgcagatgaaaatgctgatccaccaatcgttcattttggacct
ggagaaagttcttcagaagatgcagtcatgatgaacacacctgtggtgaaagcagccttg
gaaatgggctttagtagaagcttggtaaagcagacagttcagagtaaaatcctaacaact
ggagagaactacaaaacagttaatgatattgtgtcagcacttcttaatgctgaagatgaa
aacagacaagaggaaaaagaaagacaaactgaagaaatggcatcagatgatttgtcatta
attcggaagaatagaatggcgctctttcaacaattgacttgtgtgcttcctatcctggat
aatcttctaaaggccaatataattaataaacaagaacatgatataattaaacaaaagaca
cagatacctttacaagcaagagaactgattgatactgttttagttaaaggaaatgctgca
gccaacatcttcaaaaactgtctaaaagaaattgactctacattatataagaacttgttt
gtggaaaagaatatgaagtatattccatcagaagatgtttcaggactgtcactggaagaa
caattgaggaggttgcaagaagaaagaacttgtaaagtgtgcatggacaaagaagtttct
attgtattcattccttgtggtcatctggtagtatgccaggaatgcgccccttctctaaga
aaatgccctatttgccggggtataattaagggtactgttcgtacatttctctcataa

KEGG   Miniopterus natalensis: 107532418
Entry
107532418         CDS       T05883                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 3-like
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04064  NF-kappa B signaling pathway
mna04120  Ubiquitin mediated proteolysis
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04621  NOD-like receptor signaling pathway
mna04668  TNF signaling pathway
mna05132  Salmonella infection
mna05145  Toxoplasmosis
mna05168  Herpes simplex virus 1 infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107532418
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107532418
   04064 NF-kappa B signaling pathway
    107532418
   04668 TNF signaling pathway
    107532418
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107532418
   04215 Apoptosis - multiple species
    107532418
   04217 Necroptosis
    107532418
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107532418
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107532418
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532418
   05202 Transcriptional misregulation in cancer
    107532418
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107532418
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107532418
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107532418
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107532418
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107532418
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107532418
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107532418
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I32: IAP family
   107532418
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107532418
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 NikR_C DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 107532418
NCBI-ProteinID: XP_016062236
LinkDB
Position
Unknown
AA seq 604 aa
MNIVEKSEFLSNLMKRANMSEMKYDFSCELYRISTYSAFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKQGDNPIEKHKKLYPSCSFVQKLNSYHNVRAPSQLNLPSSGTHS
THSLLPNSENSGYFSGSYSSFPSNPVNSQPNEDISAWRRSPNHCIMNTENARLLTFQMWP
LTFLSPIDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHLRHFPKCPFLESRPE
DTSKYSVSNLSMQTQAARFRTFCNWPSSVPVDPQQLASAGFYYMGHNDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIRVKGREFINRIQANYPHLLEQLLSTSENPEDENAEAP
IVHFGPGENHSEDAIMMNTPVVKAALEMGFSRSLVKQTVQSKILTTGENYKVVSDLVLDL
LYAEDEIREEEKERAAEEEESDDLSYIRKNRMALSQHLTCVRPILDSLLIAGVIHEQEHD
VIRLKTQIPLQARELIDTIIVKGNFAATVFRNSLQETDPTLYKRLFVQQDIKYVPTENVS
DLPMEEQLRRLQEERTCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaagagcgaattcttatcaaatttgatgaaaagagccaacatgtct
gaaatgaaatacgacttttcatgtgaactctacagaatatctacgtattcagctttcccc
gccggtgttcctgtgtcagaaaggagtcttgcacgtgctggtttttattacactggtgtg
aatgacaaggtcaagtgcttctgctgtggcctgatgctggataactggaaacaaggagac
aaccctattgaaaagcacaaaaagttgtatcctagctgtagctttgtacagaaactgaat
tcatatcacaatgtgagagccccttctcagcttaacctgccttcttcaggaacacattcc
acacattcattacttccaaattcggaaaacagtggttatttcagtggttcttattcaagc
tttccctcaaatcctgtaaactcccaaccaaatgaagatatttctgcctggaggagaagt
cccaaccattgtataatgaacactgaaaatgccaggttgcttactttccagatgtggcca
ctgacttttctgtcaccaatagacctggcaaaagcaggtttttactacataggacctgga
gacagggtagcttgctttgcctgtggtggaaaattgagcaattgggaaccaaaggatgat
gctatgtcagaacacctgagacatttccccaaatgcccgtttttagaaagtcggcctgaa
gacacttcaaaatacagtgtttctaacctgagcatgcagacgcaggcagcccgttttaga
acattctgtaactggccctctagtgtcccagttgatcctcagcagcttgcaagtgcgggt
ttttattatatgggtcacaatgatgatgtgaaatgcttttgctgtgatggtggactgcgg
tgttgggaatctggagatgacccgtgggtagaacatgccaagtggtttccaaggtgtgag
tacttgatacgagttaaaggacgagagttcatcaatcgaattcaagccaattaccctcat
ctacttgaacagctgttatctacttcagaaaatccagaagatgaaaatgcagaggcacca
attgttcattttggacctggagaaaaccattcagaagatgcaatcatgatgaacacacct
gtggtgaaagcggccttggaaatgggcttcagtagaagcttggtaaagcagacagttcag
agtaaaatcctaacgactggagagaactataaagtcgtcagtgatcttgtattagattta
ctctatgctgaagatgaaataagggaagaggagaaggagagagcagctgaggaagaagaa
tcagatgatctatcatatatccggaagaacagaatggcactttctcaacatttgacttgt
gtgcgtccaatcctggatagtctactaattgctggagtgattcatgaacaagaacatgat
gttattagactgaaaacacagatacctttgcaagcaagagaactgattgatactattata
gtaaaaggaaattttgcagccactgtattcagaaactctctacaagaaacagaccctaca
ttatacaagcgcttatttgtacaacaagacataaagtatgttcccacagaaaatgtttca
gatttaccaatggaagaacaattgaggaggctacaagaagaaagaacatgtaaagtgtgc
atggacagagaagtgtccatagtgtttattccgtgtggtcatctcgtagtatgcaaagac
tgtgccccttctctgagaaaatgtcctatttgtagaggaacaattaagggtacagttcgt
acatttctttcatga

DBGET integrated database retrieval system