KEGG   Miniopterus natalensis: 107525066
Entry
107525066         CDS       T05883                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107525066 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107525066 (CREM)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107525066 (CREM)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf TMCO5
Other DBs
NCBI-GeneID: 107525066
NCBI-ProteinID: XP_016052634
LinkDB
Position
Unknown
AA seq 118 aa
MYPHFTDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVVAASPGSLHSPQQLAEEAT
RKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtatccccattttacagatgaggaaactgaacttgccccaagtcacatggctgctgcc
actggtgacatgccaacttaccagatccgagctcctactactgctttgccacagggagta
gttgtggctgcctcaccaggaagtttgcacagcccccagcaacttgcagaagaagccaca
cgcaaacgagagctgaggctaatgaaaaacagggaagctgcccgggagtgtcgcaggaag
aagaaagaatatgtgaaatgtcttgaaaatcgtgtggctgtgcttgaaaaccaaaacaag
actctcattgaggaactcaaggcccttaaagatctttattgccataaagcagagtaa

DBGET integrated database retrieval system