KEGG   Miniopterus natalensis: 107525082
Entry
107525082         CDS       T05883                                 

Gene name
PARD3
Definition
(RefSeq) partitioning defective 3 homolog
  KO
K04237  partitioning defective protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04062  Chemokine signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04144  Endocytosis
mna04360  Axon guidance
mna04390  Hippo signaling pathway
mna04520  Adherens junction
mna04530  Tight junction
mna05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107525082 (PARD3)
   04390 Hippo signaling pathway
    107525082 (PARD3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107525082 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107525082 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107525082 (PARD3)
   04530 Tight junction
    107525082 (PARD3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107525082 (PARD3)
  09158 Development and regeneration
   04360 Axon guidance
    107525082 (PARD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107525082 (PARD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107525082 (PARD3)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107525082 (PARD3)
SSDB
Motif
Pfam: PDZ Par3_HAL_N_term PDZ_2 PDZ_6
Other DBs
NCBI-GeneID: 107525082
NCBI-ProteinID: XP_016052648
LinkDB
Position
Unknown
AA seq 1388 aa
MAESCDAGRRGGRRKNSVKGGARGKSGGNLPVGSMELGIAVRGNTEQPLLLVPSSPLFMV
YVETPDCHLAPSGSDEDPSYWIQVHRLEHGDGGILDIDDILCDVADDKDRLVAVFDEQDP
HHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRSNMPLHVRRSS
DPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNISGSPKTCDRKKDENYRSLPR
DTSNWSNQFQRDNARSSLSASHPMVDKWLEKQEQDEDGTEDNSRVEPVGHADSGLENIPN
FSLDDMVKLVHVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEQENLFHENDCIV
RINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKNNYYSGRFSPE
SHYIDNRNVNSAGLQAPQRAPRLIHQAEQMDLHPRLPQSTQPSGKPPAAPAPAPQSVFGT
SVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGSSAPIYVKNILPRGAAIQDGRL
KAGDRLVEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQI
PKETKAEEEDVVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSII
NGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRKSMSTEGNKRGMIQLIVARRIS
KCNELKSPGSLSGPELPVETVLDDRERRISHSLYSGIERLDESPTRNVALSRIMGKYQLS
PTVNMPQDDTVIIEDDRLPMLPPHLSDQSSSSSHDDVGFVTTDPETWAKAAISDSADCSL
SPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDIVKTRKSKSMDLGIADETKLSTVDD
QKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAA
IDKSYDKPTVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSYSLERQMNGNQEKGDKT
NRRKDKTGKEKKKDRDKEKDKVKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQDSLT
SEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGISSYEGSM
ALSARPQSPREGHVMDALYAQVKKSRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDE
DVEDRRRTYSFEQPWPSSRPPAQSGRHSVSVEVQMQRQRQEERESFQQAQRQYSSLPRQS
RKNASSVSQDSWEQNYSPGEGFQSAKENPRYSSYQGSRNGYLGGHGFNARVMLETQELLR
QEQRRKEQQMKKQPPPEGLNNYDSYKNVQDPSYTLPKGPFRQDVPPSPSQVARLNRLQTP
EKGRPFYS
NT seq 4167 nt   +upstreamnt  +downstreamnt
atggcagagtcttgtgatgctggaagaaggggaggaaggaggaagaattctgtcaagggt
ggtgctcgagggaaatctggtgggaatctgcctgttggtagcatggaactgggaatagct
gtaagaggcaacacagaacagcctttgctcctggtacccagctcaccacttttcatggtt
tatgtggaaacgcctgattgccatctagcaccgagcgggtctgatgaggatccaagctac
tggatacaggtgcatcgactggaacatggagatggaggaatactggatattgacgacatc
ctctgtgatgtagcagatgataaagacagactggtagcagtgtttgatgagcaggatcca
catcatggaggtgatggcaccagtgctagctccacaggcacccagagtccagagatattt
ggcagtgaacttggtaccaacaatgtttcagcttttcagccttatcaagcaacaagtgaa
attgaggtcacaccttcagtccttcgttcaaatatgcctcttcatgtccgacgaagcagt
gacccagctttaattggcctctcaacttctgtcagtgatagtaatttttcctctgaagag
ccttcacgaaaaaaccccacacgctggtcaacaacagctggcttccttaagcaaaacatt
tctggtagccctaaaacctgtgacagaaagaaagatgaaaactacagaagcctcccccgg
gatactagtaactggtctaaccaatttcagagagacaatgctcggtcatccctgagtgct
agtcaccccatggtggacaaatggctggagaagcaagaacaggatgaggatgggacagaa
gacaacagtcgtgttgaacctgttggacatgctgacagtggtttggagaacatacccaac
ttttctctggatgatatggtaaagctcgtacacgtccccaacgatggagggcctctggga
atccatgtagtgcctttcagtgcccgaggaggcagaaccctagggttattagtaaaacga
ctggagaaaggtggtaaagctgaacaagaaaacctttttcatgagaacgattgcattgtc
aggattaatgatggtgatcttcgaaatagaagatttgaacaagcacagcatatgtttcgt
caagccatgcgcacacccatcatttggttccatgtggttcctgcagcaaataaagagcag
tatgaacaactctcccaaagtgagaagaacaattactattcaggccgctttagccctgag
agccattatattgataacaggaatgtgaacagtgcagggcttcaggcaccacagagagcg
cccagactgatccaccaggccgagcagatggacttgcacccacgactacctcagagcaca
cagccctctggaaagccaccagcagctccagccccagcaccacaaagtgtatttggtaca
agtgtaagcagtggttataataccaaaaaaataggcaagaggctgaatatccagcttaag
aaaggtacagaaggtttgggattcagcataacttccagagatgtaacaataggaagctca
gctccaatttatgtgaaaaacatccttcccaggggggctgccatccaagatggacggctg
aaggcaggggaccgcctggtagaggtcaatggagtagatttagcaggcaaatcccaagag
gaagttgtttccctgttgagaagcaccaaaatggaagggactgttagccttctggtcttt
cgccaagaagatgcctttcacccaagggaactgaatgcagagccaagccagatgcagatt
ccaaaagaaacgaaagcagaagaggaggatgttgttctcacacctgatggcaccagggaa
tttttgacatttgaagttccacttaacgattcaggatcagcaggtcttggtgtcagtgtc
aaaggtaaccggtcaaaagagaaccatgcggatttgggaatctttgtcaagtccattatt
aatggaggagcagcatctaaagatggaaggcttcgggtgaatgatcagctgatagcagtg
aatggagaatccttgttgggcaagacaaaccaagatgccatggaaactctcagaaagtct
atgtccactgaagggaacaagcgaggaatgatccagcttattgttgcgaggcgaataagc
aagtgcaatgagctcaagtcacctgggagcctctcgggacctgagttgcccgttgaaacg
gtattggatgatagagaacgaagaatttcccattccctctacagcgggattgagaggctc
gatgaatcccccacaaggaatgttgcactcagtaggataatgggaaaataccagctgtcc
cccacagtgaatatgccccaagatgacactgtcattatagaagatgacaggttgccaatg
cttcctccacatctctccgaccagtcatcttccagctctcatgatgatgtgggatttgtg
acgacagaccctgaaacctgggctaaggctgcaatcagtgattcagcagactgctctttg
agtccagatgttgatccagttcttgcttttcaacgagaaggatttggacgccagagtatg
tcagaaaaacgcacaaagcaattttcagatgccagtcaattggatatcgttaaaacacga
aaatcaaaaagcatggatttaggtatagctgacgagactaaactcagtacagtggatgac
cagaaagcaggttcccccagcagagatgtggggccttccctgggtctgaagaagtcgagc
tcattagaaagtctgcagacggcagttgctgaggtgactttgaatggggatattcctttc
catcgcccacggccacggataatcagaggaaggggatgcaatgagagcttcagagctgcc
attgacaagtcttatgataaacccacagtagatgatgatgatgaaggcatggagacattg
gaagaagacacagaagaaagctcaagatcagggagagagtctgtgtccacagccagtgac
cagccttcgtattctctggaaagacaaatgaatggaaaccaagagaaaggagataagact
aacaggagaaaggataaaactggaaaagagaagaaaaaagacagagataaggaaaaggat
aaagtgaaagccaagaagggaatgctgaagggcctgggcgacatgttcaggtttggcaaa
catcgaaaagatgacaagattgagaaaacgggtaaaataaaaatacaggactcccttact
tcagaagaggagagaatacgaatgaagcaggagcaggagaggattcaagccaaaactcga
gaatttagagagcgacaagctcgggagcgtgactatgctgaaattcaggattttcatcgg
acgtttggttgtgatgatgagttgatgtatgggggaatttcttcctatgagggttccatg
gctctcagtgccagaccccagagcccaagagaaggacatgtgatggatgctttgtacgct
caagtaaagaagtcgcggaattccaaaccttcaccagtagacagcaacagatcaactcct
agcaaccatgatcggatacagcgtctgcggcaggagttccagcaagcaaagcaggatgaa
gatgtagaagatcggcgacggacctacagctttgaacaaccctggcccagctcccggcct
ccggcgcagagcggcaggcactcggtgtccgtggaggtgcagatgcagcgccagcggcag
gaggaacgcgagagcttccagcaggcccagcgccagtacagctccctgcctcggcaaagc
aggaaaaatgccagctctgtctcccaggattcctgggagcagaactactcgcctggggaa
ggcttccagagtgccaaggagaaccccaggtactccagctaccaaggctccagaaatggc
tacctgggcgggcatggcttcaacgccagggtgatgctggagacccaggagctccttcgc
caagaacagagacggaaagagcagcagatgaagaagcagcccccccctgaggggctcaac
aactatgactcatataagaatgtccaggaccccagttacactctacctaagggaccgttc
cggcaggatgtgcctccctccccgtctcaggtcgctaggctaaacagactgcagactcct
gagaaagggagacccttctattcctga

DBGET integrated database retrieval system