KEGG   Miniopterus natalensis: 107525164
Entry
107525164         CDS       T05883                                 

Gene name
RFXAP
Definition
(RefSeq) regulatory factor X-associated protein
  KO
K08063  regulatory factor X-associated protein
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05152  Tuberculosis
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107525164 (RFXAP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107525164 (RFXAP)
  09163 Immune disease
   05340 Primary immunodeficiency
    107525164 (RFXAP)
SSDB
Motif
Pfam: RFXA_RFXANK_bdg
Other DBs
NCBI-GeneID: 107525164
NCBI-ProteinID: XP_016052745
LinkDB
Position
Unknown
AA seq 233 aa
MRPCGGPEEAAAEGVLRQVPALGGNTRAGKPIRYPCDVAGDGEEEAGEEEADLLDTSDPP
GGGESTASLEDLEDEETHSGGEGGSRGARKRGSGGGSMCKTCIYEGCSETTSQVAKQRKP
WMCKKHRNKMYKDKYKKKKSDQAQNCGGAAPAGSVGNVQLEESTDNILSIVKQRTGAFGD
RPARPTLLEQVLNQKRLSLLRSPEVVHFLQKQQQLLNQQVLEQRQQQFSGTSA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcgcccctgtggagggccggaggaagcagcggccgagggcgtcctgaggcaagttccc
gccctagggggcaacacgcgcgcgggcaagcctattaggtatccgtgtgacgtggcgggg
gatggagaggaggaagcgggggaggaggaagcggacctcctggacacttcagatcccccg
gggggaggcgagagcacagctagtctggaggacctggaggacgaagagacccactccggg
ggcgaaggaggcagcaggggagcccgtaaaaggggcagcggcgggggcagcatgtgcaag
acctgcatttacgagggctgcagcgaaaccaccagccaggtggccaagcagcgcaagccg
tggatgtgcaagaaacaccgcaacaaaatgtacaaggacaagtacaaaaagaagaaaagc
gaccaggcccagaattgcggcggagccgccccggctggcagtgtgggaaacgtccagctg
gaggaaagtacagataatatactctcaattgttaaacaaagaacaggagcttttggggat
cgtcctgcaaggcctacacttttagaacaagtgttaaatcaaaaaagactgtcattacta
agaagcccagaagtggtgcattttttacagaaacaacaacaactattaaatcagcaagtt
ttggagcaaagacagcagcagttttcaggaacatcagcatga

KEGG   Miniopterus natalensis: 107535352
Entry
107535352         CDS       T05883                                 

Gene name
RFXANK
Definition
(RefSeq) DNA-binding protein RFXANK isoform X1
  KO
K08062  regulatory factor X-associated ankyrin-containing protein
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05152  Tuberculosis
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107535352 (RFXANK)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107535352 (RFXANK)
  09163 Immune disease
   05340 Primary immunodeficiency
    107535352 (RFXANK)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_3 Ank Ank_4
Other DBs
NCBI-GeneID: 107535352
NCBI-ProteinID: XP_016066264
LinkDB
Position
Unknown
AA seq 260 aa
MELTQPTEDLSLTQQPPIPEFGDSEDPRDEAPDGSETVVLSLFPCTPEEPGNPEPDAGAS
SPQGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKEHLRKGDNLINKP
DERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERD
VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQNNLVPDDPE
NT seq 783 nt   +upstreamnt  +downstreamnt
atggagctcacccagcctacagaggacctcagcctgacccagcagccccccatcccggaa
tttggggactctgaagaccccagggatgaggccccggatggctcagaaacagtggtgctc
agtctctttccttgcaccccagaagagcctgggaatcctgaaccggatgctggcgcctct
tcacctcagggcagctccctgaagcactccacgaccctcaccaaccggcagcgggggaat
gaggtctcggccctgccggccaccctggactccctgtccatccaccagcttgcggcccag
ggagagctgagtcagctgaaggagcatctgaggaaaggcgacaacctcatcaacaagccg
gacgagcgtggcttcaccccccttatctgggcctcggccttcggagagatcgagaccgtc
cgattcttgcttgagtggggtgctgacccccacatcctggccaaggagcgggagagcgcc
ctgtcactggccagcacagggggctacacagacatcgtggggctgctgcttgagcgtgat
gtggacatcaacatctatgactggaatggagggacgccactgctctatgccgtgcgtggg
aaccatgtgaagtgcgtggaggccttgctggcccgaggagctgatctcaccactgaagct
gactccggctacaccccaatggatcttgctgtggctctgggataccggaaagtgcaacag
gtgatcgagaaccacatcctcaaactcttccagaataacctggtgcccgacgatcccgag
tga

KEGG   Miniopterus natalensis: 107539146
Entry
107539146         CDS       T05883                                 

Gene name
RFX5
Definition
(RefSeq) DNA-binding protein RFX5
  KO
K08061  regulatory factor X 5
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05152  Tuberculosis
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107539146 (RFX5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107539146 (RFX5)
  09163 Immune disease
   05340 Primary immunodeficiency
    107539146 (RFX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107539146 (RFX5)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Other basic domains
   RF-X
    107539146 (RFX5)
SSDB
Motif
Pfam: RFX5_DNA_bdg RFX5_N RFX_DNA_binding Pox_D5
Other DBs
NCBI-GeneID: 107539146
NCBI-ProteinID: XP_016071056
LinkDB
Position
Unknown
AA seq 619 aa
MAEDEPDAKSPKTARRAPSGSAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDND
KLYLYLQLPSGPSTGDKSSEPSTLSSEECMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKY
CESLACCRPLSTANFGKIIREVFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDL
KGSESPEVGTEVTPAPRDELVEAACALTCDWAERILKRSFSSIVEVARFLLQHHLISARS
THPHVLKAMGLAEEDEHAPRERTSKSKNGVENLESGAHKKPEKLTQPPQDLEPRAGAGPP
ARGERKKSIVESPAPAANNPQVNALMARLPPLLPRAPRSIIQQIPVSPPPIVSPSPIVAS
KLSSGTLKLTALPVSNRVRGSQAAVPIINMILPTVPALPGPGPAPPGGLTQPLGTENREV
GIGGDPGSHDKGVKRTAEVTVSEANGQDPLAKAAKQDIEDTGIDAKRKRGRPRKKSGGSR
ERNSAPDKSAAAVDFAQSSKLPRETWASGGESNSAGGSERPGPVGETEKRTVLAEGQEDG
AVCKGGRAPSSRHAKGGEDKIPLVTPKVSVIRGSRSQKEALHMEKGEVDTVAQSNKDLKG
HILQSSLSHEQKDPKAAPP
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggcagaagatgaacccgatgctaagagcccaaagactgcgagaagggccccctcaggt
agtgctgaggcaggggaacctaccacccttcttcagaggctccgaggtaccatttctaag
gccgtgcagaacaaagtagagggaatcttgcaagatgtacagaaattttcagacaatgac
aagctgtatctctaccttcagctcccctcagggcccagtactggagacaaaagctcagag
ccaagtacactcagcagtgaggagtgcatgtatgcctataggtggatccgcaaccaccta
gaagagcatactgatacctgtctgccaaagcaaagcgtttatgatgcctatcggaagtac
tgtgagagcctcgcttgttgccgcccactcagcactgccaactttggcaaaatcatcaga
gaggtcttccctgacatcaaggcccgaaggcttggtggccggggtcagtccaaatattgc
tacagtggcatacgaagaaagaccttggtatctatgccacccttgcctggccttgaccta
aagggctctgagagtccagaagtgggcacagaagtaaccccagcacctcgggatgaactg
gttgaggcagcctgtgccctgacctgtgactgggcagaacgaatcctgaaacggtccttc
agttccatcgttgaggtcgcccgcttcctgctacagcatcatctcatctctgcccgatct
acacatccccatgtgctcaaggccatggggcttgctgaagaagatgaacatgcccctcgg
gaacggacatctaaatctaagaatggtgtagagaacctagagagtggcgcccataagaaa
ccagaaaaattgacccagcctcctcaggatctggaaccccgagctggggctggtccccca
gcacgtggagagcggaagaagagtatagtagagagtccagccccagcagccaataacccg
caggttaatgccctgatggcccggctgcctccgctcctcccccgggcccctcgctcaatt
attcagcaaatccccgtatctcctccacccatcgtatctccttcacccatcgtggcctcc
aagctttcttcaggcactctgaaactgactgcgctccctgtgtccaatagggttagggga
tctcaggcagctgtgcccatcattaatatgatcttaccaactgttcctgctttgcctgga
cctggaccagctccacctggggggctcactcagccactgggcacagagaatagggaggta
ggcataggtggtgacccaggatctcatgacaagggtgtcaagaggacagccgaagtaact
gtgagtgaggccaatgggcaggacccactagcaaaagcagcaaagcaggatatagaggat
acagggattgatgcaaaaagaaaacgggggcgccctagaaaaaaatcaggtggaagtagg
gaaaggaattctgcccctgacaagtcagcagctgccgtggactttgcccagtcctcaaag
ttaccacgggagacgtgggcctctggaggggaaagcaactcagctggagggtcagagagg
ccagggccagtgggagagactgagaagaggacggtgcttgccgaaggtcaggaagatggt
gctgtttgtaaaggaggaagggcccctagttcccgccatgccaaaggaggagaagataaa
attcctcttgttaccccaaaagtgagtgtcatcaggggcagtagaagccaaaaggaggct
cttcatatggaaaagggagaggtagacaccgtagcacagagtaataaagatttaaagggg
catatacttcaaagttctttatcccatgagcagaaagaccccaaagcagcacccccatga

DBGET integrated database retrieval system