KEGG   Miniopterus natalensis: 107525165
Entry
107525165         CDS       T05883                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04152  AMPK signaling pathway
mna04218  Cellular senescence
mna04914  Progesterone-mediated oocyte maturation
mna05161  Hepatitis B
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    107525165 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107525165 (CCNA1)
   04218 Cellular senescence
    107525165 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107525165 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525165 (CCNA1)
   05202 Transcriptional misregulation in cancer
    107525165 (CCNA1)
   05203 Viral carcinogenesis
    107525165 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    107525165 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107525165 (CCNA1)
   05161 Hepatitis B
    107525165 (CCNA1)
   05169 Epstein-Barr virus infection
    107525165 (CCNA1)
   05165 Human papillomavirus infection
    107525165 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mna03032]
    107525165 (CCNA1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107525165 (CCNA1)
DNA replication proteins [BR:mna03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    107525165 (CCNA1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    107525165 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 107525165
NCBI-ProteinID: XP_016052746
LinkDB
Position
Unknown
AA seq 420 aa
MHLSSSKSRVVLAPVSRGPDACQMTTRAQLGQDPPQRTVLGVLTENAQYRKTCDQGITTV
RCFSGSENVFPQAGKKALSDCGFHMPAKQGFDIYMDEPEQEDKNSCTGKDRMTFEDVYEV
DTSTLKSDLHFLLDFSTVSPMLVDSSLHSQSEDASDFGTDINVAEYAEEIHQYLREAEIR
YRPKAYYMRKQPDITEGMRRILVDWLVEVGEEYKLQAETLYLAVNFLDRFLSCMSVLRGK
LQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTTN
QFLLQYLRKQGVCIRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFWP
ETLAAFTGYSLSEIVPCLSELHKACLDIPHRPQQAIREKYKISKYMHVSLMEPPAVLPLQ
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcatctcagcagctccaagagcagagtagtcctggctccagtgtcccgaggtcctgat
gcctgtcagatgacaaccagagcccagcttggccaggatcctccacaaagaacagtgcta
ggggtgctaactgagaatgcgcagtacaggaagacctgtgaccaggggatcacaacagtc
aggtgtttctctggatcagaaaatgtcttccctcaagctggaaagaaagcactctctgac
tgtgggttccacatgccagccaagcaaggatttgatatctacatggacgagcctgagcaa
gaggacaaaaacagctgcactgggaaagacaggatgacatttgaggatgtgtatgaagta
gacaccagcacactcaagtcagacctacacttcctgctggattttagcacagtttcccct
atgctggtagattcatctcttcattctcagtctgaagatgcatcagattttggtacagac
ataaatgtggctgaatatgctgaagaaattcatcagtaccttagagaagctgaaataaga
tacaggcccaaagcatactacatgaggaaacaaccagacatcacagaaggcatgagaagg
attctggtggactggctggttgaggttggagaagaatataagcttcaagctgagactctc
tacctggccgtcaactttctagacaggtttctttcgtgcatgtctgttttgagagggaaa
ttgcagcttgtaggaacagcagctattcttctggcttcgaaatatgaagaaatatatcca
cctgaagtagacgagtttgtctatataactgatgatacttacacaaaacgacaactgtta
agaatggaacacctactcctgaaagtcctagcttttgatctgacagtgccaactaccaac
cagtttctccttcagtacttgaggaaacaaggagtgtgcatcagaactgagaacctggcc
aagtacgtagcagaactgagtctacttgaagctgacccattcttgaaatatcttccttca
ttgatagctgcagcagcttattgcctggcaaactatactgtgaacaggcacttctggcca
gaaacccttgctgcatttacaggctattcattaagtgaaattgtgccttgcctgagtgag
ctacataaagcatgccttgatataccccatcgacctcagcaagcaattagggagaagtat
aagatttcaaagtacatgcatgtgtctcttatggaaccacctgcagttcttcctctacaa
taa

KEGG   Miniopterus natalensis: 107528451
Entry
107528451         CDS       T05883                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04152  AMPK signaling pathway
mna04218  Cellular senescence
mna04914  Progesterone-mediated oocyte maturation
mna05161  Hepatitis B
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    107528451 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107528451 (CCNA2)
   04218 Cellular senescence
    107528451 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107528451 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528451 (CCNA2)
   05202 Transcriptional misregulation in cancer
    107528451 (CCNA2)
   05203 Viral carcinogenesis
    107528451 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    107528451 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107528451 (CCNA2)
   05161 Hepatitis B
    107528451 (CCNA2)
   05169 Epstein-Barr virus infection
    107528451 (CCNA2)
   05165 Human papillomavirus infection
    107528451 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mna03032]
    107528451 (CCNA2)
   03036 Chromosome and associated proteins [BR:mna03036]
    107528451 (CCNA2)
DNA replication proteins [BR:mna03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    107528451 (CCNA2)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    107528451 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107528451
NCBI-ProteinID: XP_016057025
LinkDB
Position
Unknown
AA seq 428 aa
MLGNSAARAAGSAPHTSQQTAPHEDQENINPEKVSPAQQPRTRARLAVLKAGNQRGPAPP
PRPKTRRVAPLKDLPVNDEHVIVPPWKANNKQPAFTIHVDEAEEESQKSPGESKETECED
VLAFNSAITLPEPRKPLVPIDCPMDGSFESPHTMDMSVVLEDEKPVSVNEVPDYHEDIHT
YLREMEIKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLS
SMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAF
DLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLAL
YTVTGQSWPESLVQKTGYTLESLKPCLLDLHQTYLRAPQHAQQSIREKYKHSKYHGVSLL
IPPETLHV
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgttgggcaactctgcggcccgcgcggcgggctcggcgccgcacacttcgcagcagacg
gcaccccacgaggaccaggagaacatcaaccccgagaaggtgtctcccgcccagcagccc
cggacccgggccaggctggcggtactgaaggccgggaaccagcgaggtccagcgccgccg
ccgaggcccaagacgcgacgggttgcaccccttaaggatcttcctgtaaacgatgagcat
gtcattgttcctccctggaaagcaaacaataaacagcctgcatttaccattcatgtggat
gaagcagaagaagagtctcagaagagcccaggtgaatctaaagaaacagaatgtgaagat
gtcctggcatttaattcagctattactttacctgaaccaagaaaaccactggtgcctatt
gattgtccaatggatggtagttttgagtcaccacacactatggacatgtcagttgtgttg
gaagatgaaaagccagtgagtgttaatgaagtgccagactaccatgaggacattcacacg
taccttagggaaatggagattaaatgtaagcctaaagtgggttacatgaagaaacagcca
gacatcaccaacagcatgcgggccatcctcgtggactggttagttgaagtaggagaagag
tataaactccagaatgagaccctgtacctggccgtgaactacatcgacaggttcctttcc
tccatgtccgtattgagaggaaaactccagcttgtgggcaccgctgctatgctcttagcc
tcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtacattacagatgat
acctataccaagaaacaagttctaagaatggagcacctcgttctcaaagtccttgctttt
gacttggctgcgccaacagtaaatcagtttctcacccaatactttctgcaccagcagcct
gcaaactgcaaagttgaaagtttagcaatgtttttgggagagttaagcttgatagatgct
gacccataccttaagtacttgccgtcggtcattgccggagcggcctttcatctagcactc
tacacagtcacgggacagagctggcctgagtccttggtacagaagactggctataccctg
gagagtctgaagccttgcctcctggaccttcaccagacctacctcagagcgccgcagcac
gcacagcagtccatcagagagaagtacaaacactccaagtatcacggtgtttctctcctc
atcccaccggagacactacatgtgtaa

DBGET integrated database retrieval system