KEGG   Miniopterus natalensis: 107525212
Entry
107525212         CDS       T05883                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
mna  Miniopterus natalensis
Pathway
mna00561  Glycerolipid metabolism
mna01100  Metabolic pathways
mna04714  Thermogenesis
mna04723  Retrograde endocannabinoid signaling
mna04923  Regulation of lipolysis in adipocytes
Module
mna_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    107525212 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107525212 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    107525212 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    107525212 (MGLL)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107525212 (MGLL)
Peptidases and inhibitors [BR:mna01002]
 Serine peptidases
  Family S33
   107525212 (MGLL)
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 Abhydrolase_5 Thioesterase LIDHydrolase PGAP1 Abhydrolase_2 DUF1057 BAAT_C DUF1350 DUF2974
Other DBs
NCBI-GeneID: 107525212
NCBI-ProteinID: XP_016052817
LinkDB
Position
Unknown
AA seq 303 aa
MPEESSPRRTPQSVPYQDLPHLVNADGQYLFCRYWKPSRTPKALIFVSHGAGEHCGRYDE
LAQMLMGLELLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDAVQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFSGMVLISPLVLANPESATTFKVLAAKVLNLVLPNMSLGPID
SSVLSRNKTEVDLYNTDPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTTAARTG
SPP
NT seq 912 nt   +upstreamnt  +downstreamnt
atgccagaggaaagttctcccaggcggaccccgcaaagtgttccgtaccaagacctccct
catttggtcaatgctgacggacagtacctcttctgcaggtactggaaacccagccgtacc
cccaaggccctcatctttgtgtcccatggagccggggaacactgtggccgctatgatgag
ctggctcagatgctgatgggactggaactgctggtcttcgcccacgatcatgtgggccat
ggacaaagcgaaggggagaggatggtagtgtccgacttccacgttttcgtcagggatgtg
ttacagcacgtggatgcggtgcagaaagactacccggggctgcccgtcttccttctgggc
cactccatgggaggtgccatcgccatcctcacggctgcagagaggccaggccacttctcc
ggtatggttctcatttcacctttggttttggccaatccggagtccgcaacaactttcaag
gtccttgctgcgaaggttctcaaccttgtcctaccaaacatgtccctgggcccgatcgac
tccagcgtgctctctcggaataagacggaggtggatctttataacacggacccactcatc
tgccgggcaggactgaaagtgtgctttggcatccagttgctcaatgctgtctcaagggtg
gagcgggccctccccaagctgaccttgcccttcctgctgctccagggctctgctgaccgc
ctgtgcgacagcaaaggagcctacttgctcatggagtccgccaaaagccaggacaagaca
ctcaagatttacgaaggtgcctaccatgttctccacaaagagcttcctgaagtaaccaac
tccgtcttccatgaaataaacatgtgggtctctcaaaggaccacggcggcgagaacaggg
tccccaccctga

DBGET integrated database retrieval system