KEGG   Miniopterus natalensis: 107525239
Entry
107525239         CDS       T05883                                 

Gene name
MC2R
Definition
(RefSeq) adrenocorticotropic hormone receptor
  KO
K04200  melanocortin 2 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107525239 (MC2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107525239 (MC2R)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107525239 (MC2R)
   04927 Cortisol synthesis and secretion
    107525239 (MC2R)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107525239 (MC2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107525239 (MC2R)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Melanocortin
    107525239 (MC2R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw GPR_Gpa2_C
Other DBs
NCBI-GeneID: 107525239
NCBI-ProteinID: XP_016052844
LinkDB
Position
Unknown
AA seq 300 aa
MKHIINLYENINDTARNNSDCPHVVLPEEVFFTISVVGVLENLIVLLAVIRNKNLQAPMY
FFICSLAVSDMLGSLYKILENILIMLRNMGYLKPHGNFETTADDIVDSLFVFSLLGSISS
LSVIAADRYLTIFHALQYHSIVTTRRALAVLTVIWTCCAGSGVAMVIFSHHIPTVITFTS
LFPLMLVFILGLYVHMFLLARSHARKIATLPRANMKGAITLTILLGVFIFCWAPFVLHVL
LMTFCPNNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELREAFKQMIFCSRAQYNY
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaagcacatcatcaatttatatgaaaacatcaacgatacggcaagaaataactcggac
tgtcctcatgtggttttgccagaagaggtattttttacaatatccgtcgtcggggttttg
gagaatctgatcgtccttctggctgtgatcaggaataagaacctccaggcacccatgtac
ttttttatctgcagcttggccgtttccgatatgttgggaagcctgtataagatcttggaa
aatatcctgatcatgctcagaaacatgggctatctcaagcctcatggcaattttgaaacc
acagcggatgacatcgttgactccctgttcgtcttctccctgctcggctccatttccagc
ctgtcggtgatcgccgccgaccgctacctcacgatcttccatgccctgcagtaccacagc
attgtcaccacgcgccgcgcccttgctgtcctgacggtcatctggacgtgctgcgcgggc
agtggtgtcgccatggtgatcttctcccaccacatccccacggtgatcaccttcacgtcg
ctgttccctctgatgctggtgtttatcctgggcctctatgtgcacatgttcttgctggcc
cgttcccacgccaggaagatcgcgacgcttcccagagccaacatgaagggggccatcaca
ctgaccatcctgcttggggtcttcatcttttgttgggccccctttgttcttcatgtcctc
ttaatgacgttctgcccaaataacccttactgcgcctgctacatgtccctcttccaggtg
aacggcatgttgatcatgtgcaatgcggtcatcgaccccttcatttacgccttccgaagc
ccagagctcagggaagcgttcaaacagatgatcttctgcagcagggcccagtacaactat
tga

DBGET integrated database retrieval system