KEGG   Miniopterus natalensis: 107525255
Entry
107525255         CDS       T05883                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04114  Oocyte meiosis
mna04210  Apoptosis
mna04218  Cellular senescence
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04621  NOD-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107525255 (ITPR2)
   04020 Calcium signaling pathway
    107525255 (ITPR2)
   04070 Phosphatidylinositol signaling system
    107525255 (ITPR2)
   04022 cGMP-PKG signaling pathway
    107525255 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107525255 (ITPR2)
   04210 Apoptosis
    107525255 (ITPR2)
   04218 Cellular senescence
    107525255 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107525255 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107525255 (ITPR2)
   04621 NOD-like receptor signaling pathway
    107525255 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    107525255 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107525255 (ITPR2)
   04929 GnRH secretion
    107525255 (ITPR2)
   04912 GnRH signaling pathway
    107525255 (ITPR2)
   04915 Estrogen signaling pathway
    107525255 (ITPR2)
   04921 Oxytocin signaling pathway
    107525255 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    107525255 (ITPR2)
   04918 Thyroid hormone synthesis
    107525255 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    107525255 (ITPR2)
   04924 Renin secretion
    107525255 (ITPR2)
   04925 Aldosterone synthesis and secretion
    107525255 (ITPR2)
   04927 Cortisol synthesis and secretion
    107525255 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107525255 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    107525255 (ITPR2)
   04971 Gastric acid secretion
    107525255 (ITPR2)
   04972 Pancreatic secretion
    107525255 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107525255 (ITPR2)
   04725 Cholinergic synapse
    107525255 (ITPR2)
   04728 Dopaminergic synapse
    107525255 (ITPR2)
   04726 Serotonergic synapse
    107525255 (ITPR2)
   04720 Long-term potentiation
    107525255 (ITPR2)
   04730 Long-term depression
    107525255 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    107525255 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107525255 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107525255 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107525255 (ITPR2)
   05012 Parkinson disease
    107525255 (ITPR2)
   05017 Spinocerebellar ataxia
    107525255 (ITPR2)
   05020 Prion disease
    107525255 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    107525255 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107525255 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107525255 (ITPR2)
   05163 Human cytomegalovirus infection
    107525255 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107525255 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107525255 (ITPR2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  IP3 receptor
   107525255 (ITPR2)
SSDB
Motif
Pfam: RYDR_ITPR MIR Ins145_P3_rec RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 107525255
NCBI-ProteinID: XP_016052866
LinkDB
Position
Unknown
AA seq 2639 aa
MNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNVIQ
LLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKV
VLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVVRL
FHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWNSL
FRFKHLATGNYLAAELNPDYRDAQSEGKNVRDGDLPTSKKKRQAGEKIMYTLVSVPHGND
IASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQT
KEDKEAFAIVSVPLSEVRDLDFANDANKVLAMTVKKLENGTITQNERRFVTKLLEDLIFF
VADVLNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGPMLRLEDLG
DQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHNN
RKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGNA
DILIQTKLVSMQMDNPLESSILSEDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKA
DLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCRLM
LHMHVDRDPQESVVPVRYARLWTEIPTKISIHEYDSITDCSRNDMKRKFALTMEFVEEYL
KEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQVPMSS
YFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVQPSIHPSKQGSPAEQE
DVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENNENPEASTNGSPDTLIPSA
VVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLLFK
HFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSSYESGEMG
ENQVKGGEEPIEESNILSPVQDGTRTPQIDSNKSNNYRIVKEILIRLSKLCIQNKKCRNQ
HQRLLKNMGAHSVVLDLLQIPYEKSDEKMNDIMNLAHTFLQNFCRGNPQNQVLLHKHLNL
FLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGK
YVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDEGGPLAYHITLVELL
AACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIY
TSNHIWKLFENFLVDMARVCNTTTDRKHADTFMEKCVTESIMNIVSGFFNSPFSDNSTSL
QTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVNTL
FMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQFSPMMQ
AEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREML
EKKDSFVEEGNTLRKILLNRYFKGDYGVGINGHLSGTYSKSVQGGGSFSGQDSDKTAISM
SDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQKR
SEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSSLHLKEG
MKGQLTEASSATSKAYCVYRREMDPEIDIMCTGSESGNAEDKSAEEVTMSPAIAIMQPIL
RFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNV
VLVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLKN
NASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGGDEGGDDGVSPK
DVGHNIYILAHQLARHNKLLQQMLKPGSDPDDGDEALKYYANHTAQIEIVRHDRTMEQIV
FPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWF
SRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFFS
KPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVIL
DMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLA
LILVYLFSIVGFLFLKDDFTMEVDRLRNRTPGAGSNDIPTMTFTSMMGTCHKENCSPTIS
ASNTADGEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVYDL
LFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEH
IKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGDSE
QNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPPH
NT seq 7920 nt   +upstreamnt  +downstreamnt
atgaatcgatattctgcccagaaacaatattggaaagctaagcaagccaagcaggggaac
cacacggaggcggccttgctgaagaagttacagcatgctgcagaactggaacaaaaacaa
aatgaatcagaaaataagaaactcttgggagaaatcgtgaaatacagtaatgttatacaa
ctactgcacataaagagcaacaagtacctgactgtcaacaagagattgcctgccttgctg
gaaaaaaatgccatgcgcgtgtccttggacgccgccggcaacgaagggtcttggttctat
attcatcccttctggaagctgagaagcgagggtgacaatattgttgtcggagataaagtt
gttttgatgcctgtgaatgcgggacagccactacatgcaagcaacatagagcttctcgat
aacccagggtgcaaagaggtgaatgctgttaattgcaacactagctggaaaatcacttta
ttcatgaaatatagctcatatcgagaggatgtgctgaaaggaggtgacgtcgttaggttg
tttcatgcagagcaagagaagtttctgacctgtgatgaatatgagaaaaaacagcacatt
ttcctccgtacgaccttgcgtcaatcagctacttctgctaccagttctaaagcactctgg
gaaatagaggtggttcatcatgacccgtgccgtgggggcgcaggacagtggaacagcttg
ttcagatttaaacatctcgcaactgggaactacttagcagcggagcttaatcctgattat
cgagatgctcaaagtgaaggaaaaaatgtgagagatggagatcttccaacttcaaagaag
aaacgccaggcaggggagaagatcatgtacacattggtctcagtcccacatggaaatgac
attgcatccctttttgaactggatgccacaactcttcagagagctgactgcctggttcca
aggaactcctatgttcggttaagacatttatgtaccaacacctgggtaaccagtactagt
atccctatagacacagatgaagagaggcctgttatgttgaagattggaacttgccaaacg
aaagaagataaagaagcatttgccattgtgtccgtcccgctgtctgaggtgcgagactta
gattttgccaatgatgcaaataaagtgctggcgatgacggtgaaaaagctggaaaacggc
acaataactcagaatgaaaggaggtttgtaaccaaattattggaagacctcatcttcttt
gttgctgatgtacttaacaatggacaagaagttctggatgtggttatcactaagccaaac
cgagaacgtcaaaaattaatgagggaacaaaacatattggcacaggtatttgggattctt
aaagcaccttttaaggagaaagcaggagaaggcccaatgctgagactcgaagatctgggg
gaccaaagatatgctccctacaagtacatgctgaggctctgctaccgcgtgctgaggcat
tctcagcaggactaccggaaaaaccaggaatatattgctaagaatttctgtgtcatgcag
tcccagattggttatgatattttggcagaagataccatcacagctttgttgcacaacaac
agaaaactactagagaaacatattacagcaaaagaaatagaaacatttgtcagtttactc
aggagaaatcgtgagccaagattcttagattacttatcagatctgtgtgtgtccaatacc
accgctatacctgtaactcaagaactcatctgtaaatttatgttgagcccaggcaacgca
gacattctcatccaaaccaagctggtctcaatgcaaatggacaaccccctggagagctcc
atcctttcagaagacattgatgatgaagaagtgtggctctactggattgacagcaacaag
gaacctcatggcaaagctatcaggcaccttgctcaggaagccaaagaaggcaccaaagct
gacttagaagttcttacctattaccggtaccagctaaacctctttgcaaggatgtgcctg
gatcgccagtatctggccataaaccagatttcgacacagctctctgttgacttgatcctg
cgctgtgtgtcggatgagagcctgcctttcgacctccgggcatccttctgtcgcctcatg
ctccacatgcatgtcgaccgggacccgcaggagtccgtggtacctgtgcgctatgcccgg
ctctggacggagatccccacaaagatctcaattcacgaatatgattccataacggactgt
tccagaaatgatatgaagaggaaatttgcactgacaatggaatttgttgaggaatacttg
aaagaagttgtaaatcagccctttccttttggagataaagaaaaaaacaagctgacattt
gaggtggtccacttggctcggaatctcatatacttcggattttatagtttcagtgaatta
ttaaggctcacaagaacacttttggctatcctagacattgtacaggtccccatgtcatcg
tattttgaaagattaagcaaatttcaagatggaggaaacaatgtcatgagaaccatccat
ggggtgggagagatgatgacccagatggtgctcagtagaggttcaatctttcccatgagt
gtgcctgatgttcagccaagtatccaccccagcaagcaagggagccctgccgagcaggaa
gacgtgaccgtaatggacaccaaactgaagattattgagattttgcagtttatcctgagt
gtcagactagattataggatctcctacatgctgtcaatatataagaaggaatttggagaa
aacaatgagaatcctgaagcatctaccaatggctctccagatacattaataccatcagct
gttgttcctgatatagatgaaattgcggctcaggcagaaactatgtttgctggaagaaag
gaaaagaaccccgttcagcttgatgatgaaggagggaggacgtttttgcgggttctcatt
cacctgatcatgcatgactacccccctctgctgtcgggagcgctgcagctcctgttcaag
cacttcagccagcgagcagaagttctgcaggcctttaagcaggtgcagttgctggtgtcc
aatcaagatgtagataactacaagcaaataaaggcagatctagaccagcttcgactaact
gtagaaaaatctgagttatgggttgaaaagagcagcagctatgagagtggagaaatgggt
gaaaaccaagtaaaaggtggtgaagagccaatagaggaatcaaacattttaagtccagtg
caggatggaacaaggacacctcagatcgacagcaacaagagcaataactaccggattgtg
aaggagattttgattaggctaagtaagctctgcatacagaataaaaagtgtcggaatcaa
catcagcggttactgaaaaatatgggagcccattcggtggtgttggatcttctgcagata
ccctatgaaaagagtgatgagaagatgaatgacataatgaacctagcccacacgttcctg
cagaatttctgtcggggaaatccacagaatcaggttctccttcataaacatctgaatttg
tttctaactcccggcctcctcgaagcagagaccatgcggcacatcttcatgaacaattac
cacctgtgcaacgagatcagcgagagggtggtgcagcacttcgtgcactgcatcgagacg
cacggccgccacgtggagtacctgcggttcctgcagaccatcgtgaaggcggacggtaaa
tacgtgaagaagtgccaggacatggtcatgacggagttgataaatgggggtgaagatgtg
ctgatattttacaatgatagagcatcatttcccatccttctccatatgatgtgttcagag
agagaccgaggggacgagggtggccccttagcctaccacatcacccttgtggagctgctg
gcagcttgcacagagggaaaaaacgtctacactgaaatcaagtgcaactcccttctgccc
ctggacgacatagtgagggtggtgacccatgatgactgcatccctgaggttaagattgct
tatgtgaattttgtgaatcactgttacgttgacaccgaagtggaaatgaaggagatttac
acaagtaaccacatatggaaattatttgagaacttcttggtggatatggcaagggtttgc
aacacaaccacagacaggaaacacgcagacacgttcatggagaagtgtgtgaccgagtcc
atcatgaacatcgtgagcggcttcttcaactctcccttctcagataacagtaccagcctc
cagacacatcagccagtttttattcagctgctgcaatctgcctttagaatttacaactgc
acctggccaaacccagcccagaaagcctcggtggagtcctgtatcagaactttggctgaa
gtggccaagaatcgtggcattgctatcccagtggatttggatagccaagttaatactctt
ttcatgaagagccattcaaatatggtgcagagagcagccatgggttggagactgtcagct
cgctctggaccacgctttaaggaagctcttggagggcctgcttgggattatagaaatatt
attgaaaagttacaggatgtagtggcctccttggagcagcagttcagcccgatgatgcag
gctgaattctccgtgttggttgatgtgttgtacagcccagaactactgttccctgagggg
agtgatgcaaggatccgatgtggtgctttcatgtccaagttgattaatcacacaaagaaa
ctcatggagaaagaagaaaaactgtgcattaaaattcttcagactttacgagaaatgcta
gagaagaaagacagctttgtggaagagggtaacacactaagaaaaatactcctgaatcga
tactttaaaggtgattatggagttggtataaatggacacctttctggaacctacagcaaa
tctgtacaagggggaggaagtttttctgggcaagactcagataagacagcgatatcaatg
tcagatatccagtgtctactggacaaagaaggtgcatctgaacttgtcatcgatgttata
gtgaacaccaaaaatgacagaattttttcagaaggcattttgcttggcattgccttgctc
gaaggaggaaatacacagactcagtattctttctaccagcagttgcatgaacaaaaaagg
tcagaaaaattcttcaaagttctatatgaccgaatgaaggctgctcagaaagagataaga
tcaacagtgacagttaataccatagacttaggtaacaaaaaacgggacgatgacaatgaa
ttgatgacatctggcccacgaatgagagtaagagattcatcattacatttaaaagaggga
atgaaagggcaattaacagaagcctcttcagcaacatccaaagcatactgtgtgtacaga
agagaaatggatccagaaatagacattatgtgcacaggatcagaatcgggaaatgctgag
gacaaatcagcagaggaagtgacaatgagccccgcgattgcgatcatgcagccgatcctg
aggtttctccagttactgtgtgagaatcacaaccgggaactgcagaacttcttgaggaat
caaaacaacaaaacaaattacaaccttgtctgtgagacccttcagtttttggactgcatt
tgtggaagtacaacgggcggcctgggcctgttgggtctctacatcaatgagaagaatgta
gtgctggtcaaccagactctggaaagcttgaccgagtattgccagggcccgtgccatgaa
aatcagacatgtattgccactcatgaatctaatgggatcgatattatcattgctttgatt
ctaaatgacatcaaccctcttggtaaatatcgaatggacctggtgctccaactaaagaac
aatgcctccaagcttttgctggccattatggaaagcagacatgacagcgagaatgcagaa
agaattctttttaacatgagacccagggaactggtggatgtgatgaagaatgcctataac
caaggactggaatgcgatcatgggggtgatgagggcggagatgatggtgtctccccaaaa
gatgttggacacaatatctatattctggcccatcagttggcccgtcacaacaaattatta
cagcagatgctcaaaccgggatcagatccagatgatggagatgaagccttaaagtattat
gccaaccacaccgcacagattgagattgttcggcatgacaggactatggagcaaatagtt
tttcctgttcccaatatatgtgaataccttactcgagagtccaagtgccgtgtgttcaat
acaactgagagggacgagcagggaagtaaagtgaatgactttttccagcaaacagaagac
ctctacaatgaaatgaagtggcagaagaaaatcaggaataaccctgcgctgttctggttc
tcgaggcacatctctctctgggggagcatttccttcaacttggctgtgttcatcaatcta
gccgttgctctcttctacccatttggggacgatggagatgaaggtacactttctccgttg
ttctcagttcttctttggatagcagttgcaatctgcacgtctatgctgtttttcttctcc
aagcctgtgggtattcggccatttcttgtgtcagtaatgctcagatcaatatacacaata
ggtcttgggcctacattaatacttcttggtgcagctaatctttgtaataaaatcgtattt
ctggtgagctttgtcggaaaccgtggcacgttcacccgagggtaccgagcggtcatcctg
gacatggcctttctctaccacgtggcatatgtcctggtgtgcatgctgggcctctttgtc
catgaattcttctatagcttcctgcttttcgatttggtgtacagagaagagaccctgctg
aacgtgatcaaaagcgtcacccgcaacggccgctccatcatcctgacggcggtgctggcg
ctcatcctggtctacctcttctccatcgtgggcttcctcttcctcaaggacgacttcacc
atggaggtggacaggctgaggaacaggacgcccggcgcaggaagtaacgacattcctact
atgactttcacttcaatgatgggaacatgtcacaaggaaaactgctcacccacgatatca
gcttcaaatacagctgatggagaatacgaagacggcattgaaaggacgtgtgacactctc
ctgatgtgcattgtcactgtcctgaaccagggcctcaggaacggcggtggtgtgggcgat
gtgctgaggaggccatcgaaagatgagcccttgtttgctgctcgagtggtatatgacctt
cttttttatttcattgttatcattatcgttcttaacttgatttttggtgtcatcattgat
acttttgctgatctcagaagtgaaaaacagaaaaaagaagaaattctaaagacaacctgc
ttcatctgtgggctcgagagggacaagtttgataataaaactgtgtcatttgaggagcac
atcaagtcagaacacaatatgtggcattacttgtactttctcgtcttggtgaaggttaaa
gacccaactgaatacactggacctgaaagttatgtggctcaaatgattgtggagaagaat
ttggactggtttcctcggatgcgagccatgtccctcgttagcaatgaaggtgacagtgag
caaaatgagattcggaacctgcaggagaagttggaatcgaccatgagtctggtcaaacag
ctgtcaggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaataaacag
agactgggctttctcggatcaaacacgccccatgtgaaccatcacatgccgccacactga

KEGG   Miniopterus natalensis: 107529142
Entry
107529142         CDS       T05883                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04114  Oocyte meiosis
mna04140  Autophagy - animal
mna04210  Apoptosis
mna04218  Cellular senescence
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04621  NOD-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107529142 (ITPR1)
   04020 Calcium signaling pathway
    107529142 (ITPR1)
   04070 Phosphatidylinositol signaling system
    107529142 (ITPR1)
   04022 cGMP-PKG signaling pathway
    107529142 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107529142 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107529142 (ITPR1)
   04210 Apoptosis
    107529142 (ITPR1)
   04218 Cellular senescence
    107529142 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107529142 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107529142 (ITPR1)
   04621 NOD-like receptor signaling pathway
    107529142 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    107529142 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107529142 (ITPR1)
   04929 GnRH secretion
    107529142 (ITPR1)
   04912 GnRH signaling pathway
    107529142 (ITPR1)
   04915 Estrogen signaling pathway
    107529142 (ITPR1)
   04921 Oxytocin signaling pathway
    107529142 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    107529142 (ITPR1)
   04918 Thyroid hormone synthesis
    107529142 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    107529142 (ITPR1)
   04924 Renin secretion
    107529142 (ITPR1)
   04925 Aldosterone synthesis and secretion
    107529142 (ITPR1)
   04927 Cortisol synthesis and secretion
    107529142 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107529142 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    107529142 (ITPR1)
   04971 Gastric acid secretion
    107529142 (ITPR1)
   04972 Pancreatic secretion
    107529142 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107529142 (ITPR1)
   04725 Cholinergic synapse
    107529142 (ITPR1)
   04728 Dopaminergic synapse
    107529142 (ITPR1)
   04726 Serotonergic synapse
    107529142 (ITPR1)
   04720 Long-term potentiation
    107529142 (ITPR1)
   04730 Long-term depression
    107529142 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    107529142 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107529142 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107529142 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107529142 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107529142 (ITPR1)
   05012 Parkinson disease
    107529142 (ITPR1)
   05016 Huntington disease
    107529142 (ITPR1)
   05017 Spinocerebellar ataxia
    107529142 (ITPR1)
   05020 Prion disease
    107529142 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    107529142 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107529142 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107529142 (ITPR1)
   05163 Human cytomegalovirus infection
    107529142 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107529142 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107529142 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107529142 (ITPR1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107529142 (ITPR1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  IP3 receptor
   107529142 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 107529142
NCBI-ProteinID: XP_016057933
LinkDB
Position
Unknown
AA seq 2719 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHLPGELGPHFTCWEEPQRVSLADTLLFP
GFQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIG
DKVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKEDILKGGDV
VRLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYW
NSLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVP
EGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIG
TSPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLED
LVYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLE
ELGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALL
HNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNP
ANGDILIETKLVLSRFEFEGVSSGENALEAGEDEEEVWLFWRDSGKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTVFPVSPMAKGEESKGSNVMRSIHGVGELMTQVVLRGGGFLPVTPMAAAPEGNVKQTE
PEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGSSSQE
GPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGA
LQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGP
DETMDGVSGENEHKKAEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQESASLRKSRK
QQQRLLRNMSAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHI
NLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAE
GKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDESSPLMYHIHLVE
LLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKE
IYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQST
TLQTRQPVFVQLLQGVFRVYHCNWLAPGQKASVEGCIRVLSDVAKSRAIAIPVDLDSQVN
NLFLKSHNIVQKTALNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQ
AELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLR
EMMTKDRGYGEKGEALRQILVNRYYGNVRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGS
GSGSVSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQ
HSFFCRLTEDKKSERFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKRDDELDRDAPSRKK
AKEPPTQITEEARDQLLEASAATRKAFTTFRREADPDDHYPPGEGTPAAADKAKDELEMS
PVISIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGL
LGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKK
RMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEAEGEGGE
DGEDEEGGEGGEDGASPRNVGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKH
TAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFN
EMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFRGARGGTLEPHWSGL
LWTAMLVSLAIVIALPKPHGVRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSF
VGNCGTFTRGYRAMVLDVEFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIK
SVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNDTALPEAGESLASELL
YSGVCRVGTGENCSSPEPEEELLPAAEETEQDQEHTCETLLMCIVTVLSHGLRSGGGVGD
VLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTC
FICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERN
LDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQ
RIGLLGHPPHMNVNPQQPA
NT seq 8160 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtcgagtttcctgcatatcggagacatttgttccctgtacgccgag
gggtcgacaaatggatttatcagcaccttggggctggtcgacgatcgctgtgttgtgcag
ccggaaacgggggacctgaacaatccacccaagaagttccgagactgcctcttcaagctc
tgccccatgaaccgctactccgcgcagaagcagttctggaaggcggccaagccgggcgcc
aacagcaccacggacgccgtgctgctcaacaaactgcaccttcccggtgagctgggcccc
cactttacctgctgggaggagccgcagagggtcagcctcgccgacaccctcctgttcccc
gggtttcagctgctgcacctgaagagtaacaagtacctgaccgtgaacaagaggctgccc
gccctgctggagaagaatgccatgagggtgacgctggacgaggcgggcaacgagggctcc
tggttctacatccagcccttctacaagctgcggtccatcggggacagtgtggtcataggt
gacaaggtcgtcctgaaccccgtcaatgctggccagcccctacacgccagcagccaccag
ctggtggacaacccaggctgcaacgaggtcaattctgtcaactgcaacaccagctggaag
atcgtgcttttcatgaagtggagcgacaacaaggaggacatactgaaggggggggacgtg
gtgaggctgttccacgccgagcaggagaagttcctcacctgcgacgagcatcggaagaag
cagcacgtgttcctgcgcaccaccggccggcagtcggccacgtccgccaccagctccaag
gccctgtgggaggtggaggtggtgcaacacgacccctgccgcggcggagcggggtactgg
aacagcctcttccggttcaagcacctggccacagggcactacctagcggcagaggtagac
cctgactttgaggaagagtgcctggagtttcagccctcagtggaccccgaccaggacgcc
tctcggagcaggctgcgaaacgcccaggagaagatggtgtactcgctggtctccgtgccc
gaaggcaacgacatctcctccatttttgagctagaccccaccactctccgcggaggcgac
agccttgtccccaggaactcctacgtccggctccgacacctgtgcaccaacacctgggtg
cacagcaccaacatccccatcgacaaggaggaggagaagcctgtgatgctgaagatcggc
acctcgcccgtcaaggaagacaaggaggcgtttgctatcgtgcccgtctcccccgccgag
gtccgggacctggacttcgccaacgatgccagcaaggtgctgggctccatagccgggaag
ctggagaagggcaccatcacgcagaacgaaaggaggtcggtcaccaagctgctcgaggac
ttggtttactttgtcaccggtgggaccaactccggtcaggatgtgctcgaagtggtcttc
tccaagcccaaccgcgagcggcagaagctgatgcgggagcagaatatcctcaagcagatc
ttcaagctgctgcaggccccgttcacggactgcggcgacggcccgatgctgcggctggag
gagctgggggaccagcggcacgccccgttcaggcacatctgccggctctgctaccgggtg
ctcaggcactcccagcaggactaccggaagaaccaggagtacatcgccaagcagttcggc
ttcatgcagaagcagatcggctacgacgtgctggccgaggacaccatcaccgccctgctg
cacaacaaccggaagctgctggagaagcacatcacggcggccgagatcgacaccttcgtc
agcctggtgcggaagaaccgggagcccaggttcctagattacctgtccgacctctgcgtg
tccatgaacaagtccatcccggtgacccaggagctgatatgcaaagctgtgctgaaccca
gccaacggcgacatcctcatcgagaccaagctggttctgtctcggttcgagttcgagggg
gtctcctccggggagaatgccctggaagccggcgaagacgaggaggaggtgtggttgttc
tggagagacagcggcaaggagatccgcagcaagagcgtgcgggagctggcgcaggacgcg
aaggaagggcagaaggaggaccgcgacgtgctcagctactaccggtaccagctgaacctc
tttgccaggatgtgtctcgaccgccagtacctggccatcaacgagatatcgggccagctg
gacgtggacctgatcctgcgctgcatgtcggacgagaacctgccctacgacctgcgggcc
tccttctgccggctcatgctgcacatgcacgtggaccgggacccccaggagcaggtcacg
cctgtcaaatacgcccgcctctggtcggagatcccgtccgagatcgccatcgacgactat
gacagcagcgggacctccaaagatgaaattaaggagaggtttgcacagaccatggagttc
gtggaggagtatttaagagacgtggtttgtcagaggtttcccttctctgacaaggaaaag
aacaagctcacgtttgaggttgtaaatttagcgaggaatctcatatactttggtttctac
aacttctccgaccttctgcgattgaccaagatcctcctggccatcctggactgcgtgcac
gtgaccacagtcttccctgtcagcccgatggcgaaaggagaggagagcaaaggcagtaac
gtgatgcggtccatccatggggtcggggagctgatgacccaggtggtgctccggggaggg
ggctttctgcccgtgacccccatggccgccgcccccgaaggcaacgtgaaacagacagag
ccggagaaggaggacatcatggtcatggacaccaagctgaagatcatcgagatcctccag
tttatcttgaacgtgaggttggactacaggatctcctgcctcctgtgtatattcaagcgg
gagtttgacgaaagcaattcccagacttcggaaacgtcctccgggagcagcagccaggag
gggcccagcaacgtgccgggtgctctggactttgaacacatcgaggagcaggcggagggc
atcttcggaggaagtgaggagaacaccccgctggacctggacgaccacggtggcaggacc
ttcctccgggtcctgctgcacctgacgatgcatgactacccacccctggtgtcgggggcc
ctgcagctgctcttccgacacttcagccagaggcaggaggtcctgcaggccttcaaacag
gttcaactgctcgttaccagccaagacgtcgacaactacaagcaaatcaagcaggacttg
gaccagctgaggtccatcgtggagaagtccgagctctgggtgtacaaggggcagggccct
gacgagaccatggacggtgtgtctggagaaaacgaacataagaaggcggaggaggggaac
aacaagtcccagaagcacgagagcaccagcagctacaactacagggtggtcaaggagatc
ttgatccggctcagcaagctgtgcgtgcaggagagcgcgtccctgcgcaagagccgcaag
cagcagcagcggctgctcaggaacatgagcgcgcacgctgtggtgctggagctgctgcag
atcccctatgagaaggcagaggacaccaagatgcaggagataatgcggctggcgcacgag
tttctgcagaacttctgcgcgggcaaccagcagaaccaggccctgctgcacaagcacatc
aacctgtttctcaaccctgggatcctggaggcggtgacgatgcagcacatcttcatgaac
aacttccagctgtgcagcgagatcaacgagcgggtggtccagcacttcgtgcactgcatc
gagacccacggccgcaacgtgcagtacatcaagttcctgcagaccattgtcaaggccgag
gggaagttcatcaagaagtgccaggacatggtcatggcggagctggtgaactccggggag
gacgtcctcgtcttctacaacgacagggcgtccttccagacgctgatccagatgatgcgg
tcggagcgggaccgcatggacgagagcagcccgctcatgtaccacatccacctggtggag
ctgctggccgtgtgcaccgagggcaagaacgtctacaccgagatcaagtgcaactcgctg
ctcccgctggacgacatcgtccgcgtggtcacccacgaggactgcatccccgaggtgaaa
atcgcctacatcaacttcctgaaccactgctacgtggacaccgaggtggagatgaaggag
atttacaccagcaaccacatgtggaagctgttcgagaatttccttgtggacatctgcagg
gcctgcaataacacgagcgaccggaagcacgcggactccatcctggagaagtacgtgacc
gagatcgtcatgagcatcgtgacgaccttcttcagctcgcccttctcggaccagagcacc
acgctgcagacccgccagcccgtgttcgtgcagctgctgcagggcgtgttccgcgtgtat
cactgcaactggctggcgcccggccagaaggcctcggtggagggctgcatccgcgtgctc
tccgacgtggccaagagtcgggccatcgccatccctgtggacctggacagccaggtcaac
aacctcttcctcaagtcccacaacatcgtgcagaagacggccctgaactggcggctgtcg
gcccgcaacgcggctcgccgggactcggtgctggcggcttccagggactaccggaacatc
atcgagaggctgcaggacatcgtctcggcgctggaggaccggctgcggcccctggtccag
gcggagctgtcggtgctggtggacgtgctgcacaggcccgagctgctcttcccggagaac
accgacgccaggaggaagtgcgaaagcgggggcttcatctgcaagctgatcaagcacacc
aagcagctgctggaggagaacgaggagaagctctgcatcaaggtcctgcagacgctcagg
gagatgatgacgaaggaccgcggctacggagagaagggcgaggcgctcaggcagattttg
gtcaaccgttactatggaaacgtcagaccgtccggaagaagagagagcctcactagcttc
ggcaacggcccgctgtcgccaggaggacccagcaagcccgggggcggagggggaggctcc
gggtccggctccgtgagcaggggcgagatgagcctggctgaggtgcagtgccacctggac
aaggagggcgcctccaacctggtcatcgacctcatcatgaacgcgtccagcgaccgagtg
ttccacgagagcatcctcctggccatcgccctcctggaaggaggcaacaccaccatacag
cattccttcttctgccggctgacggaagataagaagtcggagcggttcttcaaggttttc
tacgaccgaatgaaggtggcccagcaggagatcaaggcaactgtgacagtgaacaccagt
gacctggggaacaaaaagagagacgacgagctggacagggacgccccgtcccggaaaaaa
gccaaagagcccccgacgcagataacggaggaggcgcgcgaccagctcctggaggcctcg
gccgccaccaggaaggccttcaccaccttccggagggaggccgaccccgacgaccactac
ccgcctggggagggcacgccggccgcggcggacaaggccaaggacgagctggagatgagc
ccggtgatcagcatcatgcagcccatcctgcgcttcctgcagctcctgtgcgagaaccac
aaccgcgacctgcagaacttcctccgctgccaaaacaacaagaccaactacaacctggtg
tgtgagacgctgcagttcctggactgcatctgcggcagcaccacgggcggcctggggctg
ctggggctctacatcaacgagaagaacgtggccctcatcaaccagaccctggagagcctc
accgagtactgccaggggccctgccacgagaaccagaactgcatcgccacccacgagtcc
aacggcattgacatcatcacggccctgatcctgaacgacatcaaccccctggggaagaag
agaatggacctcgtgctggagctgaagaacaacgcctcgaagctgctgctggccatcatg
gagagcaggcacgacagcgagaacgccgagcgcatcctctacaacatgcggcccaaggag
ctggtggaggtgatcaagaaggcctacatgcagggggaggcggagggcgagggtggcgag
gacggcgaggacgaggagggcggcgagggcggtgaggacggcgcctcgccccggaacgtg
ggccacaacatctacatcctggcgcaccagctggctcggcacaacaaggagctgcagagc
atgctgaagccggggggccaggtggatggagacgaagcgctggagttctacgccaagcac
acggcccagatcgagattgtcaggctggaccggaccatggagcagatcgtcttccccgtg
cccagcatatgcgagttcctgaccaaggagtccaagctgcgcatctactacaccacagag
cgggacgagcagggaagcaagatcaacgacttcttcctgcgctccgaggacctcttcaac
gagatgaactggcagaagaagctccgagcccagcccgtgctgtactggtgtgcccgcaac
atgtccttctggagcagcatctccttcaacctggccgtgctcatgaacctgcttgtcgcc
ttcttctaccccttcagaggcgcccgcggagggacgctggagccgcactggtcagggctg
ctgtggacggcaatgctcgtctcgctggccatcgtcatcgcgctccccaagccccacggc
gtccgcgccctgatcgcctccacgatcctgcggctgatcttctccgtggggctgcagccc
acgctctttctcctgggagccttcaacgtctgcaataagatcatctttctgatgagcttc
gtgggcaactgcggcaccttcacccggggctaccgtgccatggtcctggacgtcgagttc
ctctaccacctgctgtacctgctgatctgcgccatggggctctttgtccacgagttcttc
tacagcctgctgctcttcgacttggtgtaccgcgaggagaccctgctcaacgtcatcaag
agcgtgacccgcaacgggcgctccatcatcctgacggcggtgctggcgctcatcctggtc
tacctcttctccatcgtgggctacctgttcttcaaagacgacttcatcctggaggtggac
cggctgcccaacgacaccgccctcccagaagccggcgagagcttggccagcgagttgctg
tactcgggcgtgtgcagggtgggcaccggagagaactgctcctctcctgaacccgaggaa
gagctgctccccgccgccgaggagacggagcaggaccaggagcacacgtgcgagaccctg
ctgatgtgcatcgtcaccgtgctgagccacgggctgcggagcgggggcggcgtgggcgac
gtgctcaggaagccgtccaaagaggagcccctgttcgccgccagagtcatctacgacctc
ctgttcttcttcatggtcatcatcatcgtgctgaacctcatctttggggtgatcatcgac
accttcgccgacctgaggagcgagaagcagaagaaggaggagatcctcaagaccacatgc
ttcatctgcggcttggaaagagacaagttcgacaacaagactgtcacctttgaggagcac
atcaaggaagagcacaacatgtggcactacctgtgtttcatcgtgctggtcaaggtcaag
gactccacggagtacaccgggcccgagagctacgtggcagaaatgatcaaggaaaggaac
ctcgactggttcccccggatgagagccatgtccttggtcagcagcgactcggagggcgag
cagaacgagctgaggaacctgcaggagaagctcgagtccaccatgaagctggtcaccaac
ctctctggccagctgtccgagctgaaggaccagatgacagaacaaaggaagcagaagcag
agaatcggccttctaggacatcctccgcacatgaacgtcaacccccagcagcccgcgtga

KEGG   Miniopterus natalensis: 107541588
Entry
107541588         CDS       T05883                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04114  Oocyte meiosis
mna04210  Apoptosis
mna04218  Cellular senescence
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04621  NOD-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107541588 (ITPR3)
   04020 Calcium signaling pathway
    107541588 (ITPR3)
   04070 Phosphatidylinositol signaling system
    107541588 (ITPR3)
   04022 cGMP-PKG signaling pathway
    107541588 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107541588 (ITPR3)
   04210 Apoptosis
    107541588 (ITPR3)
   04218 Cellular senescence
    107541588 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107541588 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107541588 (ITPR3)
   04621 NOD-like receptor signaling pathway
    107541588 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    107541588 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    107541588 (ITPR3)
   04922 Glucagon signaling pathway
    107541588 (ITPR3)
   04929 GnRH secretion
    107541588 (ITPR3)
   04912 GnRH signaling pathway
    107541588 (ITPR3)
   04915 Estrogen signaling pathway
    107541588 (ITPR3)
   04921 Oxytocin signaling pathway
    107541588 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    107541588 (ITPR3)
   04918 Thyroid hormone synthesis
    107541588 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    107541588 (ITPR3)
   04924 Renin secretion
    107541588 (ITPR3)
   04925 Aldosterone synthesis and secretion
    107541588 (ITPR3)
   04927 Cortisol synthesis and secretion
    107541588 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107541588 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    107541588 (ITPR3)
   04971 Gastric acid secretion
    107541588 (ITPR3)
   04972 Pancreatic secretion
    107541588 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107541588 (ITPR3)
   04725 Cholinergic synapse
    107541588 (ITPR3)
   04728 Dopaminergic synapse
    107541588 (ITPR3)
   04726 Serotonergic synapse
    107541588 (ITPR3)
   04720 Long-term potentiation
    107541588 (ITPR3)
   04730 Long-term depression
    107541588 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    107541588 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    107541588 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    107541588 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107541588 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107541588 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541588 (ITPR3)
   05012 Parkinson disease
    107541588 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    107541588 (ITPR3)
   05017 Spinocerebellar ataxia
    107541588 (ITPR3)
   05020 Prion disease
    107541588 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    107541588 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107541588 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107541588 (ITPR3)
   05163 Human cytomegalovirus infection
    107541588 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541588 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107541588 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107541588 (ITPR3)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107541588 (ITPR3)
Ion channels [BR:mna04040]
 Ligand-gated channels
  IP3 receptor
   107541588 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 107541588
NCBI-ProteinID: XP_016074193
LinkDB
Position
Unknown
AA seq 2674 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKISDVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLDEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPGYKGDASDPKAAAVGAQGVQGRASRRNAGEKIKYRLVAV
PHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDVEEERPIRLML
GTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLE
DLVFFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVR
LEELSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITA
LLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVL
DPKNSDILIQTELRPVKEMAQAHEYLTIEYSEEEVWLTWSDKNNEHHEKSVRQLAQEARA
GNAHDENVLSYYRYQLKLFARMCLDRQYLAIHEISQQLGVELIFLCMADEMLPFDLRASF
CHLMLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNAARDDKKNKFASTMEFV
EDYLNNVVSEAVPFANEDKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLSIIDCVQG
PPALLQAYEDTGGKNVRRSIQGVGHMMSTMVLNRKQSVFGAPNLPAEAGAAEPLDRSKFE
ENEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFD
STTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQL
LFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGE
EVEAGPAKDKKERPTDEEGFLPPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLL
KNMDAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPG
LLEAETMQHIFLNNYQLCSEVSEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKC
QDMIMTELTNAGDDVVMFYNDKASLTHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAE
GKNVYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHI
WTLFENFTLDMARVCSKREKRLADPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTI
VVQLLQSTTRLLECPWLQQQHKGAVEACIRTLAMVAKGRGIALPMDLDAHISLLLSSGAS
CVAAAQRNASNYKAATRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVL
VDVLHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMQSEEKLCVKVLRTLQQMLLKKA
KYGDRGNQLRKMLLQNYLQNRKSSSRGDLPDPMGIGLDQDWSAIAATQCRLDKEGATKLV
CDLITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQ
QETKSTVAVNMSDLGSQPREDREPADPTTKGRVASFSMPGSSSRYSLGSSLRRGHEVGER
VQSNEMGMSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGS
TTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILND
ISPLCKYRMDLVLLLKDNASKLLLGLMESRHDSENAERILVSLRPQELVDVIKKAYLQEE
ERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLS
QMLKSSPPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFT
TTEQDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINI
IIAFFYPYVEGASTGVLDSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLG
IGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSILGLFAH
ELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFIL
EVDRLPANHSRASPLGMPHGAATFMGTCSGDRMNCVSGVSVTEILEEDEELDSTERACDT
LLMCIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNVIFGVII
DTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYFIVLVRV
KNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVS
HLTAQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8025 nt   +upstreamnt  +downstreamnt
atgagcgagatgtccagctttcttcacatcggagacatcgtctctctgtacgccgagggc
tcggtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagcct
gctgctggggacctggacaaccccccaaagaagttccgagactgcctcttcaaggtgtgt
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaagac
aaggagaagatctccgacgtggtgctgctgcagaagttgcagcatgcagcccagatggag
cagaagcagaacgacacggagaataagaaggtgcacggggacgtcgtcaagtacggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacggtgaacaagcggctgccg
gccctgctggagaagaacgccatgcgggtgacgctggacgccacgggcaatgagggctcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaatgtggtggtgggg
gacaaggtcatcctgaatcctgtcaacgctgggcagcctctgcatgccagcaattacgag
ctcagtgacaacgccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgtttatgcagttccgagaccacctggatgaggtgctgaaagggggagacgtg
gtgcggttgttccacgcggagcaggagaagttcctgacgtgcgacgagtacaagggcaag
ctgcaggtgttcctgcgcaccacactgcgccagtccgccacctcggccaccagctccaac
gccctctgggaggtggaggtagtccaccatgacccctgccgtggaggagctggccactgg
aacggcctgtaccgcttcaagcatctggccacaggcaactacctggctgctgaggagaac
cccggctacaagggtgatgcctctgatcccaaggcagcagctgtgggtgcgcagggtgtg
cagggtcgcgcaagtcgccggaacgctggggagaagatcaagtaccgccttgtggctgtc
ccccacggcaacgacatcgcctcgctttttgagctggaccccaccacgctgcagaaaacg
gactcctttgtgcccaggaactcctatgttcggctgcggcatctctgtaccaacacgtgg
atccagagcaccaatgtgcccattgatgtcgaggaggagcggcccatccggctcatgctg
ggcacctgccccaccaaggaggacaaggaggcctttgccattgtgtcggttcctgtgtct
gagatccgagacctggactttgccaatgatgccagctccatgctggccagcgctgtggag
aaactgaacgagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggag
gatctggtgttctttgttagcgatgtccccaacaatgggcagaacgtcctggacatcatg
gtcaccaagcccaaccgggaacggcagaagctgatgagggagcagaacatcctcaagcag
atctttggcattctgaaggctcccttccgcgacaaggggggcgagggccccctggtgcgg
ctggaggagctgtcagaccagaagaacgccccctaccagcacatgttccgcctctgctac
cgggtgctgcgacattcccaggaggactaccgcaagaaccaggagcacatcgccaagcag
tttgggatgatgcagtcccagattggctatgacatcctggccgaagacaccatcactgcc
ctgctgcacaacaaccgcaagctcctggagaagcacatcaccaagacagaggtggagacc
ttcgtcagcctggtgcgcaagaaccgggagcccaggttcctggactacctttccgacctg
tgtgtgtccaaccacattgccatccccgtcacccaggagctcatctgcaagtgtgtgctg
gaccccaagaacagtgacattctcatccagactgagctccggccggtgaaggagatggcc
caggcccacgagtacctgaccatcgagtactcagaggaggaagtgtggctcacttggagc
gacaagaataatgagcaccacgagaagagtgtgaggcagctggcccaggaggcgcgggcg
ggcaatgcccacgacgagaacgtgctcagctactacaggtaccagctgaagctcttcgcc
cgcatgtgcctggaccggcagtacctggccatccacgagatctcccagcagctgggcgtg
gagctcatcttcctgtgcatggccgacgagatgctgccctttgacctgcgcgcctccttc
tgccacctgatgctgcacgtgcacgtggaccgcgacccgcaggagctggtcacgcctgtc
aagtttgcccgcctctggactgagatccctacggctatcaccatcaaggactacgattcc
aacctcaatgccgcccgagatgacaagaagaacaagtttgccagcaccatggagttcgtg
gaggactacctcaacaacgtggtcagcgaggccgtgccctttgccaacgaggacaagaac
aagctcaccttcgaggtggtcagcctcgcgcacaatctcatctacttcggcttctacagc
ttcagcgagctgctgcgactcacccgcacgctgctcagcatcatcgactgcgtgcagggc
cctccggccttgctgcaggcctacgaggacacaggcggcaagaatgtgcggcggtccatc
cagggcgtgggccacatgatgtccaccatggtgctgaaccgcaagcagtctgtctttggt
gcccccaacctgcctgcggaggccggggctgctgagccgctggacagaagcaagttcgag
gagaatgaagacatcgtggtcatggagaccaagctgaagatcctggagatcctgcagttc
atcctcaacgtccgcctggattaccgcatctcctatctgctgtccgtcttcaagaaggag
tttgtggaggtgtttcccatgcaggacagtggggctgatggcacggcccctgccttcgac
tccaccactgccaacatgaacctggatcgcatcggggagcaggcagaggccatgtttgga
gtggggaagacaagcagcatgctggaggtggacgacgagggcggccgcatgttcctgcgc
gtgctcatccatctcaccatgcacgactacgcgccgctggtctcgggcgccctgcagctg
ctcttcaagcacttcagccagcgccaggaggccatgcacaccttcaagcaggtgcagctg
ctgatctcagctcaggacgtggagaactacaaggtgatcaagtcggaactggaccggctc
cgcaccatggtcgagaagtcggagctgtgggtggacaagaagggcagcggcaagggcgag
gaggtggaggcaggccccgccaaagacaagaaggagcggcccacggacgaggaaggcttt
ctgcccccgcctggggagaagagcagcgagaactaccagatcgtcaagggcatcctggag
cggctgaacaagatgtgcggcgttggggagcagatgaggaagaagcagcagcggctgctc
aagaacatggatgcccacaaggtcatgctggacctgttgcagatcccctacgacaagggc
gacgccaagatgatggagatcctgcgctacacacaccagttcctgcagaagttctgtgcg
gggaaccccggcaaccaggccctgctgcacaagcacctgcacctcttcctcacgccgggg
ctcctggaggcagagaccatgcagcacatcttcctgaacaactaccagctctgctcggag
gtcagcgagcctgtgctgcagcactttgtgcacctgctggccacccacgggcgccatgtg
cagtacctggacttcttgcacactgtcatcaaggccgagggcaagtacgtcaagaagtgc
caggacatgatcatgactgagctgaccaacgcgggtgatgacgttgtcatgttctacaat
gacaaagcctcactgacccacctgctggacatgatgaaggctgcccgggacggcgtggag
gaccacagccccctcatgtaccacatctccttggtggacctgctggccgcctgtgccgag
ggcaagaacgtctacacggaaatcaagtgcacctccctgctgcccctggaggacgtggta
tcagtggtgacacatgaggactgcatcaccgaggtgaaaatggcctacgtgaacttcgtg
aaccactgctacgtggacacggaggtggaaatgaaggagatctacaccagcaaccacatc
tggacactctttgagaacttcaccctggacatggctcgggtctgcagcaagcgggagaaa
cgcctggcagaccccaccctggagaagtatgtgctgactgtcgtgctggacaccatcaat
gccttcttcagctccccgttctccgagaacagcacctccctgcagacacaccagacgatc
gtggtgcagctgctgcagtccaccacgcggctgctcgagtgcccgtggctgcagcagcag
cacaagggcgcggtggaggcctgcatcaggaccctcgccatggtggccaagggcaggggc
atcgcactgcccatggacctggatgcccacatcagcttgctgcttagcagtggtgccagc
tgtgtggctgctgcccagcggaatgcttccaactacaaggcagccacacgggccttccct
cgagtcacccccactgccaaccagtgggactacaagaacatcatcgagaaactgcaggac
atcatcacagccctggaggagcgcctgaagcccctggtgcaggccgagctgtccgtgctg
gtggacgtgctgcactggcccgagctgctcttccttgagggcagcgaggcctaccagcgc
tgcgagagcgggggcttcctgtccaagctgatccagcacaccaaggacctcatgcagtca
gaggagaagctgtgcgtcaaggtgctgcggactctgcagcagatgctgctcaagaaggcc
aagtacggggaccggggcaaccagctacgcaagatgctgctgcaaaactacctccagaac
cggaagtccagctcgcggggggaccttccggaccccatgggcattggcctggaccaagac
tggtcagcaattgcagccacccagtgccggctggacaaggagggggccaccaagctggtg
tgtgacctcatcactagcaccaagaacgagaagatcttccaggagagcatcggtctggcc
atccgcctgctggatggtggcaacacagagatccagaagtccttctacaacctgatgacg
agtgacaagaagtcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccag
caggagaccaagtccacggtggccgtcaacatgagtgacctgggcagccagccccgcgag
gaccgggagccggcagaccccaccaccaaaggccgcgtggcctccttctccatgcctggc
tcctcgtcccgctattcgctgggctccagcctgcgccgggggcatgaggtgggcgagcgt
gtgcagagcaacgagatgggcatgtctgtgctcatcatgcagcccatcctgcgctttctg
cagctgctgtgcgagaaccacaaccgggacctgcagaacttcctgcgctgtcagaacaac
aagaccaactacaacctggtgtgcgagacgctgcagttcctggacatcatgtgcggcagc
accacggggggcctggggctgctggggctctacatcaacgaggacaacgtgggcctcgtg
atccagaccctggagaccctcaccgagtactgccagggcccctgccacgagaaccagacc
tgcatcgtgacgcacgagtccaatggcatagacatcatcactgcgctgattctcaacgac
atcagtcccctgtgcaagtaccggatggacctggtgctgctactcaaggacaatgcctcc
aagctgctcctgggcctgatggagagccgacacgacagcgagaacgccgagcgcatcctc
gtcagcctgcggccccaggagctggtggacgtcatcaagaaggcctacctgcaggaggag
gagcgtgagaactccgaggtgagcccgcgcgaagtgggccacaacatctacatcctggcg
ctgcagctctccaggcacaacaaacagctgcagcacctgctgaagcctgtgaagcgcatc
caagaggaggaggcggagggcatctcctccatgctgagcctcaacaacaagcagctgtca
caaatgctcaagtcctcaccgcctgcgcaggaggaggaggaggaccccctggcctactat
gagaaccatacgtcccagatcgagatcgtgcggcaggaccgcagcatggagcagattgta
ttccccgtgcctggcatctgccagttcctgacggaggagaccaagcaccggctcttcacc
accacagagcaggacgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttc
ctgcacaacgagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttc
tcccgccgcatgaccttgtggggcagcatctccttcaacctggccgtgtttatcaacatc
atcatcgccttcttctacccctacgtagagggcgcatccacaggagtgctggactccccg
ctcatctcgctgctcttctggatcctcatctgcttctccatcgccgccctgttcaccaag
cgctacagtgtccgcccgctcatcgtggcgctcatcctgcgctccatctactacctgggc
attgggcccacgctcaacatcctgggtgccctcaatctgaccaacaagattgtgttcgtg
gtgagcttcgtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggac
atggagttcctctaccatgtgggctacatcctgactagtatcctgggcctctttgcccat
gagctgttctacagcatcctgctctttgacctcatttaccgtgaggagactctgttcaat
gtcatcaagagcgtgacccgcaatggccgctccatcctgctgaccgccctgctggccctc
atcctggtctacctcttctccatcgtcggcttcctcttcctcaaggacgacttcatcctc
gaggttgaccggctgcccgccaaccactccagagccagccccctggggatgccacatgga
gctgccacattcatgggcacgtgcagcggggacaggatgaactgtgtctcaggggtctcg
gtgactgagatcctggaagaggacgaggagctggacagcacggagcgagcctgtgacacc
ctgctgatgtgcattgtcaccgttatgaaccatgggctgcgcaatggtggtggcgtgggc
gacattctccgcaagccctctaaagatgagtctctgttcccggcccgcgtggtctacgac
ctcctgttcttcttcattgtcatcatcattgtgctgaacgtcatcttcggggtgatcatt
gacacctttgctgacctgcgcagcgagaagcagaagaaagaggagattctcaagaccacg
tgtttcatctgtggtctggagagggacaagtttgataacaagacagtgtcatttgaggag
cacatcaagttcgagcacaacatgtggaactacctgtacttcatcgtgctggtccgagtg
aaaaacaagacggactacacggggcccgagagctatgtggcccagatgatcaagaacaag
aacctggactggttcccccggatgcgggccatgtccctcgtcagcaacgaaggggagggg
gagcagaacgagatccggattctccaggacaagctgaactccaccatgaagctggtgtcc
caccttactgcccagctcaacgagctcaaggagcagatgacggagcagcggaagcgcagg
caacgcctgggctttgtggacgtccagaactgcatgagccgctga

DBGET integrated database retrieval system