KEGG   Miniopterus natalensis: 107525278
Entry
107525278         CDS       T05883                                 

Gene name
PDE3A
Definition
(RefSeq) cGMP-inhibited 3',5'-cyclic phosphodiesterase A
  KO
K19021  cGMP-inhibited 3',5'-cyclic phosphodiesterase A [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107525278 (PDE3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107525278 (PDE3A)
   04022 cGMP-PKG signaling pathway
    107525278 (PDE3A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107525278 (PDE3A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107525278 (PDE3A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107525278 (PDE3A)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 107525278
NCBI-ProteinID: XP_016052899
LinkDB
Position
Unknown
AA seq 998 aa
MGLCLLRAGVRLPLAVALLAACCGGEALAQVGLGVGEDHLLSLPAAGVVLSCLAAATWLV
LRLRLRLGVLMIAVTSALRTVSLISLERFRAAWRPYLAYLAGVLGILLARYVERILPQSA
GAAAREPFGSQLIAGTKEEIPVLKRRRRSSSVVSAEMSGCSSKSHRRTSLPCIPREQLMG
HSEWDHKRGPRGSQSSGTSITVDIAVMGEAHGLITDLLADPSLPPNVCTSLRAVSNLLST
QLSFPAIHKPRVNPVVSFSENYTCSDSEEGSEKDKLAIPKRLRKSLPPGLLRRVSSTWTT
TTSATGLPTLEPAPVRRDRSASIKLHESPLTGAVSSDSWNNPAMMTLTKSRSFTSSYALS
SANYVKAKKPNRPGALAKISPLSSPCSSPLQGTPASSPVSKISTVQFPESADTAAKQGLG
SHRALTYTQSAPDLSPQILVPPVICSGCGRPYSQGNAADGPLERSGAAIRTPSRTDDTAQ
VTSDYETNNNSDSSDIVQNEDETECPREQLRKASACSAYAPETMIFLDKPILAPEPLVMD
NLDSIMEQLNTWNFPIFDLVEKIGRKRGRILSQVSYRLFEDMGLFEAFKIPVREFMNYFH
ALEIGYREIPYHNRIHATDVLHAVWYLTTQPIPGLSTVINDHGSASDSDSDSGFTHGHMG
YVFSKMYSVPDDKYGCLSGNIPALELMALYVAAAMHDYDHPGRTNAFLVATSAPQAVLYN
DRSVLENHHAAAAWNLFMSRPEYNFLVNLDHVEFKHFRFLVIEAILATDLKKHFDFVAKF
NAKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKSKELHLQWTEGIVNEFYEQGDEEA
SLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAGLMPGKWVEDGDESGDTDDPE
EEEAAADEEETCENNESPRKKTFKRRKIYCQITQHLVQNHQMWKKVIEEEQRLAGIENQS
PDQSPQQHPSEHIQAIREEDEEKGKPRGEETLTPKPNQ
NT seq 2997 nt   +upstreamnt  +downstreamnt
atgggcttgtgcctcctgcgcgccggggtgcgcctgcctctggccgtcgcgctgctggcc
gcctgctgcggaggggaggcgctcgcgcaggtcgggctgggcgtcggggaggaccacttg
ctgtcgctccccgccgcgggggtggtgctcagctgcctggccgcggcgacatggctggtg
ctgaggctgaggctgaggctgggcgtcctcatgatcgccgtgactagcgcgctcaggacc
gtgtccctcatttccttggagaggttcagggccgcctggagaccttacctggcgtacttg
gccggagtgctggggatcctcctggccaggtacgtggagcgaatcttgccgcagtcggcg
ggggctgccgcgagggagccttttgggtcccagctgatcgctgggaccaaagaagagatc
ccggtgttaaagaggaggcggcggtccagctccgtggtgtccgccgagatgtcgggctgc
agcagcaagtcccatcgccggacctccctgccgtgcataccgagggaacagctcatgggg
cattcagaatgggatcacaagcgagggccaagaggatcacagtcctcaggaaccagtatt
actgtggatatcgccgtgatgggggaggctcacggcctcatcaccgacctcctggccgac
ccttctctgccccccaacgtgtgcacgtccttgcgggcagtgagcaacctgctcagcacc
cagctctccttcccggccattcacaagcccagagtgaatcctgtcgtctccttcagtgaa
aactacacctgttctgattctgaagaaggctctgaaaaagacaagctggctattcccaag
cgcctgagaaagagcttgccccccggattgttgagacgagtttcgtcgacttggacaacc
accacctcagccacaggcctgcccactttggagcctgccccagtgcggagggatcggagc
gccagcatcaaactgcatgagtcgcctttaaccggtgctgttagttctgattcttggaat
aacccagcgatgatgaccctcaccaaaagcagatccttcacttcgtcctatgccctttct
tcagctaactatgtaaaggctaaaaagccaaatcgcccaggtgccctcgctaaaatttca
cctctttcatcgccctgttcctcacctctccaagggactccggccagcagtccggtcagc
aaaatttctacagttcagtttccagaatctgcggacacagctgctaaacaaggcctaggc
tctcacagggccttaacttacactcagagtgcccctgacctgtctcctcagatcctggtt
ccacctgttatatgtagcggctgtggcaggccatattcccaaggcaatgctgctgatggg
cccctggagagaagcggtgcggccattcggacaccgagcagaacggatgacactgctcaa
gttacctctgattatgaaaccaataacaacagtgacagcagcgacatagtgcagaatgaa
gacgagaccgagtgcccaagagagcaactgaggaaagcatcggcttgtagcgcctacgcg
cctgagaccatgatattcctggacaaaccaatccttgctcctgaaccccttgtcatggat
aacttggactcgattatggagcagctaaatacttggaattttccaatttttgatttggtg
gaaaaaataggaaggaaacgtggccgtattcttagtcaggtatcatacagactttttgaa
gacatgggcctctttgaagctttcaaaattccagttagggaatttatgaattactttcat
gctttggagattggatacagggaaattccttatcataacagaatccatgctactgacgtc
ttacatgctgtttggtatcttactacacagcctattccaggcctctcaactgtgattaat
gatcatggatcagcaagtgattcagattctgacagtggatttacacatggacacatggga
tatgtgttctcaaaaatgtatagtgtgccggatgataaatacgggtgtctgtctggaaat
atccctgccttagagctgatggcgctgtatgtggctgcggccatgcacgactatgaccac
ccaggaaggactaatgcattcctggttgcaaccagtgctcctcaggcggtgctctataat
gaccgctcagtcctggagaatcatcacgcagctgctgcatggaatcttttcatgtcccgg
ccagagtataacttcttagttaaccttgaccatgtggaatttaagcatttccgtttcctt
gtcattgaagcaattttggccactgacttgaagaaacactttgactttgtagccaaattt
aatgccaaggtaaatgatgatgttggaatagattggaccaatgaaaacgatcgtctgcta
gtttgtcaaatgtgtataaagttggccgatatcaatgggccagctaaaagtaaagagctc
catcttcagtggacagagggtattgtcaatgaattttacgaacagggcgacgaagaggcc
agcctggggctcccgataagccctttcatggaccgctctgcccctcagctggccaacctc
caggaatcctttatctcgcacatcgtgggcccgctgtgcaactcctatgactctgcggga
ctcatgccagggaaatgggtggaagacggcgatgagtcgggagataccgatgacccggag
gaggaggaggcggcggccgatgaagaggaaacctgtgaaaataacgagtctccaagaaag
aaaactttcaaaaggaggaaaatctactgccaaataactcagcacctcgtgcagaaccac
cagatgtggaagaaagtcatcgaagaggaacagaggttggcaggaattgaaaatcagtcc
ccagaccagtctccccagcagcatccctcagaacacatccaggccatcagagaagaagat
gaagaaaaagggaagccaagaggagaggagaccctcaccccaaagccaaaccagtga

KEGG   Miniopterus natalensis: 107526434
Entry
107526434         CDS       T05883                                 

Gene name
PDE7A
Definition
(RefSeq) high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A isoform X1
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107526434 (PDE7A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107526434 (PDE7A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107526434 (PDE7A)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 107526434
NCBI-ProteinID: XP_016054368
LinkDB
Position
Unknown
AA seq 483 aa
MEICYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHAQSEIEVSVSARNIRRLLSFQRYLRS
SRFFCGTTVSNSLNILDDDYNGQAKCMLGKVGNWNFDIFLFDRLTNGNSLVSLTCHLFSL
HGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLREPKLANSVTPW
DVLLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HMPLESRKQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDARHRHLVLQMALKC
ADICNPCRTWELSKQWGEKVTEEFFHQGDIEKKHQLVVSPLCDRQTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTEAALEELNSQLLPQEN
RLS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggaaatatgttaccagctgccggtgctgcccctggacaggccggtcccccagcacgtc
ctcagccgccgaggagccatcagcttcagctccagctccgcgctcttcggctgccccaat
ccccggcagctctcccagaggcgtggagctatttcctatgacagttctgatcagactgca
ttatacattcgtatgcttggagatgtacgcgtaaggagtcgagcaggatttgaatcagaa
agaagaggttctcatccatatatcgattttcgtatttttcatgctcaatctgaaattgaa
gtttctgtgtctgcaaggaacatcagaaggttattgagtttccaacggtatcttagatcg
tcacgctttttttgtggtactaccgtttcaaattctctaaacattttagatgatgattat
aatggacaagccaagtgtatgctgggaaaagttggaaattggaattttgatatctttcta
tttgatagactaacaaatggaaatagtctagtaagtttaacctgccatttatttagtctt
catggactaattgagtacttccatttagatatggtgaaactccgtagatttttagttatg
attcaagaagattaccacagtcagaacccttaccacaatgcagtccacgctgcagacgtc
actcaggccatgcactgttacttacgagaacctaagcttgccaactctgtaactccttgg
gatgtcttgctgagcttaattgcagctgccactcatgatctggatcatccaggtgttaat
caacctttccttattaaaactaaccattacttggcaactttatacaagaatacctcagta
ctggaaaatcaccactggagatctgcagtggggttattgagagaatctggtttattctca
catatgccattagagagcaggaaacaaatggagactcagatcggtgctttgatactagcc
acagacatcagtcgccaaaacgagtatctgtcgttgtttaggtcccatttggatagaggt
gacttatgcctggaagatgccagacataggcatttggttttacagatggctttgaaatgt
gctgatatttgtaacccatgtcggacctgggaattaagcaagcagtggggtgaaaaagta
acagaggaattcttccatcaaggagacatagagaagaagcatcagctggttgtgagtccg
ctttgtgaccgtcagacggagtcgattgccaacatccagattggttttatgacttaccta
gtggagcctttattcacagaatgggccaggttttccaataccaggctgtcccagacgatg
ctcgggcacgtggggctgaataaagccagttggaagggactgcagagggagcagtccagc
agcgaggacaccgaagctgcccttgaggagttgaactcacagttattacctcaggaaaac
cggttgtcatag

KEGG   Miniopterus natalensis: 107530988
Entry
107530988         CDS       T05883                                 

Gene name
PDE7B
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 7B
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107530988 (PDE7B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107530988 (PDE7B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107530988 (PDE7B)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 107530988
NCBI-ProteinID: XP_016060414
LinkDB
Position
Unknown
AA seq 417 aa
MSCLMVERCGELLFENPDQNVKCVCMLGDVRLRGQTGVPAERRGSYPFIDFHLLNNTTHS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLQN
KDLRLEDVHDRHFLLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFELEIS
PLCNQQKDSIPSIQIGELNSVLILKEYFRHLCQESQRQDNLCKAFERPNLGLESMSP
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtcttgtttaatggttgagaggtgtggtgaactcttgtttgaaaaccctgatcagaat
gtcaaatgtgtttgcatgctaggagatgtacgactaaggggtcagacgggggttcctgct
gaacgccgcggctcctacccattcatcgacttccacctacttaacaatacaacacactca
ggggaaatcggcaccaagaaaaaggtgaaaagactgttaagctttcaaagatacttccat
gcgtcaaggctgctccgtggaattataccacaggcccctctccacctgctggatgaagac
taccttggacaagcaaggcatatgctctccaaagtgggaatgtgggattttgacattttc
ttgtttgatcgcttgacaaatggaaacagcctggtaacactgctatgccacctcttcaac
acccatggactcattcaccatttcaagttagatatggtgaccttacacaggtttttagtc
atggttcaagaagattaccacagccagaacccatatcacaatgctgtccacgcagccgat
gtcacccaggccatgcactgctacctgaaggagccaaagctcgccagcttcctcacacct
ctggacatcatgcttgggctgctggctgcagcagcgcacgatgttgaccacccaggggtg
aaccagccctttttgatcaaaactaaccaccacctcgccaacctatatcagaatatgtct
gtgctggagaatcaccactggcgatctacgattggcatgcttcgagaatccaggcttctt
gctcacttgccaaaggaaatgacacaggatattgaacagcagctgggctccttgatcttg
gcaacagacatcaacagacagaatgaatttttgaccagattgaaagctcacctccaaaat
aaagacttaaggctggaggatgtccacgacaggcactttctgcttcagattgccttgaag
tgtgctgacatttgcaatccctgcagaatctgggagatgagcaagcagtggagtgaaagg
gtctgtgaagagttctacaggcaaggtgaccttgaacagaaatttgaactggaaatcagt
ccactctgtaatcaacagaaagattcaatccctagtatacaaattggtgagttgaattca
gttttaattttaaaggaatattttcggcacctctgccaagagtcacaaaggcaagacaat
ctatgcaaagcttttgaaagacccaacctgggacttgaatcaatgtccccgtga

KEGG   Miniopterus natalensis: 107532953
Entry
107532953         CDS       T05883                                 

Gene name
PDE10A
Definition
(RefSeq) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
  KO
K18438  cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04024  cAMP signaling pathway
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107532953 (PDE10A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107532953 (PDE10A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107532953 (PDE10A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107532953 (PDE10A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     107532953 (PDE10A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C HD H_kinase_N
Other DBs
NCBI-GeneID: 107532953
NCBI-ProteinID: XP_016062982
LinkDB
Position
Unknown
AA seq 809 aa
MVNICPLCLAYWTHFQVSFMLYIYQNIIPFYGQIIFHCLTDEKVKAYLSLHPQVLDEFVS
ESVSVETVEKWLKRKNNKLEDESTPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLL
LYELSSIIKIATKADGFALYFLGECNNSLCVFTPPGIKEGKPRLIPAGPIAQGTTTSAYV
AKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCVPIVTAIGDLVGILELYRHWGKEAF
CLRHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIM
IYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPIFKKTKEIRFSIEKGIAGQVA
RTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSK
TDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMRFSLP
GRLCKEIELFHFDIGPFENMWPGIFVYMIHRSCGTSCFELEKLCRFIMSVKKNYRRVPYH
NWKHAVTVAHCMYAILQNNRGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAAL
YSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQL
EEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKK
LGIQPIPMMDRDKRDEVPQGQLGFYNAVAIPCYTTLTQIFPPTEPLLKACRNNLNQWEKV
IQGEESAMWFSSQPVAPGTSEKLPVKIDD
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggtaaatatttgccctttgtgtctggcttattggactcattttcaagtctccttcatg
ttgtacatatatcagaacatcattccattttatggccaaataatattccattgtttgaca
gatgaaaaagtgaaggcctatctttctcttcacccccaggtattagatgaatttgtgtct
gaaagtgttagtgtggagacggtagaaaaatggctgaagaggaagaacaacaagctggaa
gatgagtctacccccaaggaagtcagcaggtaccaagatacgaacatgcagggagttgtg
tatgaactgaacagctacatagaacagcgactggacacaggtggagacaaccagctgctg
ctgtatgaactgagtagcatcattaaaatagccacgaaagcagacggatttgcactgtat
ttccttggagagtgcaataatagcctgtgcgtgttcactccccctggaatcaaggaagga
aagccccggctcatccctgcaggccccattgcacagggcactaccacctctgcctacgtg
gccaagtctaggaagactctgcttgtggaagacatcctcggggatgaacgatttccaaga
ggcactgggctggaatcagggacacggatccagtctgtcctctgtgtgcccatcgtcact
gcgatcggcgacctggtgggcatccttgagctgtaccggcactggggcaaggaagccttc
tgcctgcgccatcaagaggtggcaacagcaaatcttgcctgggcttcagtcgcaattcat
caggtgcaggtatgcagaggccttgccaaacagactgaactgaatgactttctactcgac
gtatcaaaaacatactttgataacatagtcgcaatagattctctacttgaacacataatg
atatatgcaaaaaacctggtgaatgcagatcgctgtgcactcttccaggtggaccataag
aacaaggagttgtattcagacctttttgatattggagaggaaaaggaaggaaaacctatc
ttcaagaagaccaaagaaatcagattttccattgagaaaggaattgctggccaagtagca
agaacaggggaggtactgaacattccagatgcctacgcagacccacgctttaacagggaa
gtggacctatacacgggctacaccacccggaacatcctgtgcatgcccatcgtgagccgg
ggcagcgtgatcggcgtggtacaaatggtcaacaagatcagcggcagtgccttctccaag
acagatgagaacaacttcaagatgttcgcagtcttctgtgcgctggccttgcactgcgcc
aatatgtaccacaggattcggcactcagagtgcatctaccgggtgaccatggagaagctg
tcctaccacagcatctgcacggccgaggagtggcagggcctcatgcgcttcagcctgccc
gggcgcctctgcaaggagatcgagctattccactttgacattggtcctttcgaaaacatg
tggcctgggatttttgtctatatgattcatcgttcctgtgggacatcctgctttgagctt
gaaaagttgtgtcgttttatcatgtccgtgaagaagaactaccggcgggtcccataccac
aactggaagcacgcggtgaccgtggcgcactgcatgtacgccatcctgcagaacaaccgc
gggctcttcactgacctggagcgcaaagggctgctgatcgcgtgtctgtgtcacgacctg
gaccacaggggcttcagtaacagctacctgcagaagttcgaccacccactggccgccctc
tatagcacgtccaccatggagcagcatcacttctcccagaccgtgtccatcctgcagttg
gaagggcacaatatcttctccaccctgagctccagtgagtacgagcaggtgcttgagatc
atccgcaaagccatcatcgccacagaccttgccctctactttgggaacaggaagcagttg
gaggagatgtaccagacaggatcgctgaacctcaacaaccagtcacatagggaccgtgtc
attggcttgatgatgactgcctgtgacctctgctccgtgacaaagctgtggccagttaca
agactgacggcaaatgacatctatgcagaattctgggctgagggtgacgagatgaagaag
ctggggatacagcccattcctatgatggaccgggacaaacgggatgaggtcccacaaggc
cagcttggattctacaacgcggtggccatcccctgctacaccaccctcacccagatcttc
ccgcccacagagccactcctcaaagcctgcaggaataacctcaaccagtgggagaaggta
atccaaggggaggagagtgcaatgtggttctcatcccagccggtggccccagggacctca
gagaagctgcctgtgaagattgacgactga

KEGG   Miniopterus natalensis: 107533245
Entry
107533245         CDS       T05883                                 

Gene name
PDE4A
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4A isoform X1
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04024  cAMP signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107533245 (PDE4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107533245 (PDE4A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107533245 (PDE4A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533245 (PDE4A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107533245 (PDE4A)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 107533245
NCBI-ProteinID: XP_016063331
LinkDB
Position
Unknown
AA seq 865 aa
MEPPAVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAEHAEPERP
PHRPIERANAVDTSDRPGLRTSRMSWPSSFHSTGSGGAGGGSCRRFEAENGPTPSPGRSP
LDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAYAEDLIVTPFA
QVLASLRSVRSNFSLLTNVPIPSNKRSPLSGPTPVCKATLSEETCQQLARETLEELDWCL
EQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEIPS
PTMKDGEKAPRQRPSQQPPPPGPQFQPMSQIMGVKKMMHSSSLTDSSIPRFGVKTDQEEL
LAQELENLNKWGLNIFHVSDYARGRSLSCIMYTIFQERDLLKKFHIPVDTMVTYMLTLED
HYHQDVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQF
LINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLAT
DMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQ
WTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPD
AREILDTLEDNRDWYYSAIRQSPSPPPEEEPEGPGHPTPPDKFQFELTLDEEEEEEASSA
ALGAIEVQELFVAQDVSAAEELLEVDGQDVSAEVEVEEMFLTQQADSVAVGQDKSTSPDA
LMDAVGYSSPHVLSPESPALPALRTPSTPEEAPGLLGLPSVAAEVGAQKEHQAAKRVCCA
CTGTLGEDPPTLPAPGGWGSAAGPI
NT seq 2598 nt   +upstreamnt  +downstreamnt
atggagcccccggccgtcccctcggagaggagcctgtctctgtctctgcccgggccccgg
gagggccaggccaccctgaagccgcctccccagcacctgtggcggcagccgcgaactcca
atccgtatccagcaacgcggttactcggacagcgcggagcacgcagagcccgagcggcca
ccacaccggcccatagagcgcgccaacgctgtggacaccagcgaccggcccggcttgcgc
acgtcccgcatgtcctggccctcgtccttccacagcaccggcagcggcggcgcgggcgga
ggcagctgcaggcgcttcgaggcagagaatgggccgacgccatcgcccggccgcagcccc
ctggactcgcaggcgagcccgggccttgtgctgcatgccggggcagccaccagccagcgc
cgtgaatccttcctctaccgctcagacagcgactatgacatgtcgcccaagaccatgtcc
cggaactcgtcagtcaccagcgaggcgtatgctgaggacctcatcgtgacaccatttgct
caggtgctggccagtctccggagtgttcgcagcaacttctcactcctgaccaatgtgccc
attcccagcaacaagcgatccccattgagtggcccaaccccggtatgcaaggccacactg
tcagaggagacctgtcagcagttggcccgggagacattggaggagctggactggtgtctg
gagcagctagagaccatgcagacctaccgctcagtcagcgagatggcatcgcacaagttc
aagaggatgctaaaccgggaactcacacacctgtcagagatgagcaggtcaggaaaccag
gtctctgagtacatctccaccacattcctggacaagcagaatgaagtggagatcccatca
cccacgatgaaggatggagaaaaagcacctcggcaaagaccctcccagcagcctccgccc
cctgggccgcagttccagcctatgtctcagatcatgggggtgaagaagatgatgcatagc
agcagcctgaccgattccagcataccccgctttggggtgaagacagaccaagaggagctc
ctggcccaagagctggagaacctgaacaagtggggcctgaacatctttcacgtgtcagat
tatgctagaggccgttcccttagctgcatcatgtacacaatattccaggaacgggacctg
ctgaagaagttccacatcccagtggacacaatggtgacatatatgctgactctggaggac
cactaccaccaggatgtggcctaccacaacagcctgcacgctgccgatgtgctgcagtcc
acccatgtgctgctggccacacctgcgctggacgctgtattcacagacctggagattctc
gcagcccttttcgcagctgccatccacgacgtggaccaccctggggtttccaaccagttc
ctcatcaacaccaattcagagctggcgctcatgtacaatgacgagtcggtgctggagaac
caccacctggccgtgggtttcaagctgctgcaggaggacaactgtgacatcttccagaac
ctcagcaaacgccagcggcagagcctgcgcaagatggtcatcgacatggtgctggccacg
gacatgtccaagcatatgaccctcctagctgacctgaagaccatggtagaaacgaagaaa
gtgaccagctcaggggtccttcttctggacaactactctgaccgcatccaggtcctgagg
aacatggtgcactgtgcggacctcagcaaccccaccaagccgctggagctgtaccgccag
tggacagaccgtatcatggctgagttcttccagcagggcgaccgtgaacgagagcgtggt
atggagatcagccccatgtgtgacaagcacacagcctcggtggaaaagtctcaggtgggt
ttcatcgactatattgtgcacccactgtgggagacatgggctgacttggtccacccagac
gcccgggagatcctagacacattggaagataaccgggactggtactacagcgccattcgg
cagagcccgtcgccacctcccgaggaggagcctgaggggccaggccacccaaccccacct
gataagttccagtttgagctgacgctagatgaggaagaggaggaggaggcgtcctccgct
gccctgggtgcaattgaggtgcaggaattattcgtggcccaggatgtatccgcagctgag
gaactgttggaggtcgatggccaagatgtgtctgcagaggtggaggtagaggaaatgttc
ttgacacagcaagcagacagtgtggctgtgggccaggacaagtccacatccccagatgca
ttgatggatgccgtgggctacagcagcccccatgtcctgtctcctgagagccccgctctg
cctgccttgaggaccccatccactccagaggaggccccgggcctcctgggcctcccctcc
gtggcagcagaggtgggggcccagaaagagcatcaagctgccaagagggtgtgctgtgcc
tgcacagggacgttgggcgaggacccacccacactcccagcccctggtgggtgggggtct
gctgcaggccctatctga

KEGG   Miniopterus natalensis: 107533530
Entry
107533530         CDS       T05883                                 

Gene name
PDE4B
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4B isoform X1
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04024  cAMP signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107533530 (PDE4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107533530 (PDE4B)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107533530 (PDE4B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533530 (PDE4B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107533530 (PDE4B)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR DFP YlqD
Other DBs
NCBI-GeneID: 107533530
NCBI-ProteinID: XP_016063744
LinkDB
Position
Unknown
AA seq 588 aa
MSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTLLTNLHGTSNKRSPAASQPPVSRV
NLQEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSG
NQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRF
GVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFKISSDTF
VTYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDV
DHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFQNLTKKQRQTLRK
MVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNP
TKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWE
TWADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLEEED
PEGPVKEGEGHNYFSSTKTLCVIDPENRDSLGETDVDTAAEDKSPIDT
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcgagaaactcttcgcttcctagcgagcaacacggcgatgacttgattgtaacacct
tttgcccaggttctcgccagcttgagaagtgtgagaaacaacttcactctactgacaaac
cttcatggaacatccaacaagaggtccccagctgctagtcagcctcctgtctccagagtc
aacctgcaagaagaatcttatcaaaagttagcaatggaaactctggaggaattggactgg
tgcttagaccagctagagaccatacagacctaccgctccgtcagtgagatggcttcgaac
aagttcaaaaggatgctgaaccgggagctgacacacctctcagaaatgagccgatcaggg
aaccaggtgtctgaatacatttcaaatactttcttagacaagcagaatgacgtggagatt
ccatctcccacccagaaagacagagagaaaaagaaaaagcaacagctcatgacacagata
agcggagtgaaaaagctgatgcatagttcaagcttaaacaataccagcatctcacgcttc
ggagtcaacacggaaaatgaagatcatctagccaaggagctggaagacctgaataaatgg
ggccttaacatcttcaatgtagccggatattcacacaacaggcccttgacgtgcatcatg
tatgccatattccaggaaagagacctcctaaagacattcaaaatctcctctgatacattt
gtaacctacatgatgacgttagaagaccattaccattctgatgtggcatatcacaacagc
ctacatgctgctgatgtagcgcagtctacccatgttcttctctcaacaccagcactcgat
gccgtcttcacagatttggaaatcctcgccgccatttttgcagctgctatccatgatgtt
gaccatcctggagtatccaaccaatttctcatcaacacaaattcagaacttgctttgatg
tataatgacgaatctgtgttggaaaaccatcatctggccgtgggtttcaagctgctgcaa
gaagagcattgtgacatctttcagaatctcaccaagaagcagcgccagacactcaggaag
atggttatcgacatggtgttagcaactgatatgtccaaacatatgagcctgctggcagac
ctgaagacaatggtagaaacaaagaaagttacaagttcaggcgttcttctgctggacaac
tatactgatcgtatacaggtccttcgcaatatggtgcactgtgcagacctgagcaacccc
accaagtccttggaactgtaccggcaatggacagaccgcatcatggaggaatttttccag
cagggagacaaagagcgggagagaggaatggagattagcccaatgtgtgacaagcacacg
gcttctgtggagaaatcccaggttggtttcatcgactacatcgtccatccactgtgggag
acctgggcagatctggtgcagcccgatgcccaggacattctggatacattagaagataac
aggaactggtatcagagcatgataccccagagtccctccccgccgctggacgagcagaac
agagactgccaggggctgatggagaagtttcagtttgaactgacccttgaagaggaagat
cctgaaggacctgtaaaagagggagagggccacaactatttcagcagcacaaagacactt
tgtgtgatcgaccccgaaaacagggattcactgggagagactgatgtagacactgctgca
gaggacaagtccccgattgacacataa

KEGG   Miniopterus natalensis: 107533656
Entry
107533656         CDS       T05883                                 

Gene name
PDE2A
Definition
(RefSeq) cGMP-dependent 3',5'-cyclic phosphodiesterase
  KO
K18283  cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04740  Olfactory transduction
mna04925  Aldosterone synthesis and secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107533656 (PDE2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107533656 (PDE2A)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107533656 (PDE2A)
  09157 Sensory system
   04740 Olfactory transduction
    107533656 (PDE2A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533656 (PDE2A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107533656 (PDE2A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Other DBs
NCBI-GeneID: 107533656
NCBI-ProteinID: XP_016063927
LinkDB
Position
Unknown
AA seq 941 aa
MVLSGPTSNHRATDPGIPVLRALGSGLSSEFLKLIWDHSDLPFPLFQDALLSLGSVIDIA
GLRQAVKEAISAVLPRVETVYTYLLDRESRLVCEDPPHELPQEGKVREAVISRKRLGCNG
LGLSDLPGKPLAKLVAPLAPDTQVLVIPLADKETGAVAAVILVHCGQLSDSEEWSLQAVE
KHTLVALRRVQALQQRRPGVAPEAVQTPPAGTAGDEKGXAAYTYRDGKILQLCGELYDLD
ASSLQLKVLQYLQQETHASRCCLLLVSEDNLQLSCKVIGDKVLEEDVSFPLTMGRLGQVM
EDKESIQLKDLTSEDVRQLQNMLGCELQTMLCVPVISRATDQVVALACAFNKLGGDSFTD
QDKHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVEDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENKEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVASIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFVSCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPELDGTRGPVNGCCSLDTE
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtgctgagtggccctacctccaaccacagagctacagatcctggaattccagttctg
agagccttgggctctggtttaagctcggagtttctaaagctcatatgggaccactctgac
ctgccctttcctctcttccaggatgctttgctgagcctgggctctgtcatcgacattgca
ggcttgcgccaggctgtcaaggaggccatttcagccgtgctccccagagtggagactgtc
tacacctacctgttggacagggagtcgcggctggtgtgtgaggaccctccccacgagctg
ccccaggaaggaaaagtgcgagaggctgtgatctcccggaagcggctgggttgtaatgga
ctggggctctcggacctgcctgggaagcctttggccaagctggtggccccactggctcct
gacacccaagtgctggtcataccgctggcggacaaggagactggggctgtggcagctgtc
atcttggtgcactgtggccagctgagtgacagtgaagagtggagccttcaagcagtggag
aagcataccctggtggccctgcggagggtgcaggccctgcagcagcgccggcccggcgtg
gcccccgaagctgtccagacgcccccggcggggacggcgggagacgagaagggnnnggcg
gcgtacacctaccgggacgggaaaatcctgcaactgtgcggggagctctacgacctggac
gcctcttccctgcagctgaaagtcctccaatacctgcagcaggagactcatgcatcccgc
tgctgcctcctgctggtgtccgaggacaatctacagctctcctgtaaggtcatcggagat
aaagtgctggaggaagatgtcagctttccgttgacgatgggacgcctgggccaggtgatg
gaagacaaggagtctatccagctgaaagatctcacctcagaggatgtgcgacagctgcaa
aacatgttgggctgtgagctgcagaccatgctctgtgtccctgtcatcagccgggccacg
gaccaggtggtggccttggcctgtgccttcaacaagctcggaggagactcattcaccgac
caggacaaacatgtgatccagcattgctttcactacaccagcacggtgctcaccagcacc
ctggcattccagaaggagcagaagctcaagtgtgagtgccaggctcttcttcaagtggca
aagaacctcttcactcacctggatgacgtctctgtcctgctccaggagatcatcacagag
gccagaaacctcagcaatgctgagatctgctccgtgttcctgctggatcaaaatgagctg
gtggccaaggtgttcgacgggggcgttgtggaggacgagagctatgagatacgcatcccg
gccgatcagggcatagcgggccacgtggcgactacaggccagatcctgaacatcccggac
gcatacgcgcacccgcttttctaccgcggtgtggacgacagcacgggtttccgcacgcgc
aacatcctctgcttccccatcaagaacgagaacaaggaggtcatcggtgtggccgagctg
gtgaacaagatcaatggaccatggttcagcaagttcgatgaggacctggccacggccttc
tccatctactgcggcatcagcatcgcccattccctcctttacaagaaagtgaatgaggcc
cagtatcgcagccacctcgccaatgagatgatgatgtaccacatgaaggtctctgatgat
gaatataccaaacttctccatgatgggatccagcccgtggcttccattgactccaacttc
gccagtttcacctacacccctcgctctcttcccgaggatgacacttccatggccatcctc
agcatgctgcaggacatgaatttcatcaacaactataaaattgactgcccgacactggcc
cggttctgtttgatggtaaagaagggctaccgggacccaccctaccacaactggatgcac
gccttctctgtctctcacttctgctacctgctctacaagaacctggagctcaccaactac
ctcgaggacatcgagatctttgccttgtttgtttcctgcatgtgtcatgacctggaccac
agaggcacaaacaactccttccaggtggcctcgaaatctgtgctggctgcgctctacagc
tctgagggctctgtcatggagaggcaccacttcgctcaggccatcgccatcctcaacacc
catggttgcaacatcttcgaccacttctcccggaaggactatcagcgtatgctggacctg
atgagagacatcatcctggccacagacctggcccaccacctgcgcatctttaaggacctc
cagaagatggctgaagtgggctatgatcgaaccaataagcagcaccacagcctcctcctc
tgcctccttatgacctcctgtgacctctctgaccagaccaagggctggaagaccacaagg
aagattgcagagctgatctacaaagagttcttctcccagggagatttggagaaggccatg
ggcaacaggccaatggagatgatggaccgtgagaaggcttacatccctgagctgcagatc
agcttcatggagcacatcgcaatgcccatctacaagctgctgcaggacctgttccccaaa
gcggcagagctgtatgaacgcgtggcctctaaccgtgagcactggaccaaggtgtcgcac
aagttcaccatccgaggcctcccgagcaacaactcactggacttcctggatgaggaatat
gaggtgcctgagctagatggcactaggggccctgtcaatggctgttgcagccttgacact
gagtga

KEGG   Miniopterus natalensis: 107534338
Entry
107534338         CDS       T05883                                 

Gene name
PDE11A
Definition
(RefSeq) dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
  KO
K13298  dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 [EC:3.1.4.17 3.1.4.35]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04934  Cushing syndrome
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107534338 (PDE11A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107534338 (PDE11A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107534338 (PDE11A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107534338 (PDE11A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     107534338 (PDE11A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 HD
Other DBs
NCBI-GeneID: 107534338
NCBI-ProteinID: XP_016064935
LinkDB
Position
Unknown
AA seq 932 aa
MTASPLDFGEVETFLDRHPDLLEDYLMRKGKQEMVEKWLQRHSQSQGALGPRPALAGTSG
VAHGGGRGSSSSVGGGTGPNGLGNSQPTPGGGDCGGVPLSPSWASGCRSDGNQQQRASQK
ELRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESR
VNLPQYPPTAMDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCS
LFLVERVAAGKKSLVSKLFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNI
PDAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVM
QMYLPFCGIAISNAQVFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLK
CERCSVLLLEDIESPVVKFTKSFELMSPKCSADSENSFKESVEKSSYSDWLINNSVAELV
ASTGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSSHQIIGVAQVLNRLDGKPF
DDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAAN
IPLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYR
MVLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKS
GSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTL
YFERRTEFFELVSKGEYDWNIKTHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFF
EQGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVS
ANRRKWEELHQKRLLVSAAAPSPAVVAGAHSN
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgacagcgtcccccctggattttggggaggtggaaactttcctggacaggcacccagac
ttgcttgaagattacttgatgcggaaggggaagcaggagatggtggagaagtggctgcag
aggcacagccagagtcagggggctctaggccccaggcctgcactggctggcaccagtggc
gtggctcacggaggtggcagaggcagcagcagcagcgttggtggtggcactggaccaaat
ggtttgggcaacagccagcccactcctggtggcggggactgtggtggggttccgctgagt
cccagctgggccagtggctgccggagcgatgggaaccagcagcagagagcttctcagaaa
gagctaaggaagagttttgcccgctccaaagccatccacgtgaacaggacctatgatgaa
caagtgacctcccgggcccaggagcccctgagcagtgtgcggcgaagggcacttctccgg
aaggccagctccctaccccccaccacagcccatattctcagtgccctgctggaatcgagg
gtgaacctgcctcagtatccccctacggccatggactacaagtgccacctcaaaaagcat
aatgagcgtcagttctttctggaattggtcaaggatatctccaatgaccttgaccttacc
agcctgagctacaagatcctcatctttgtctgcctcatggtggacgctgaccgctgctct
cttttcctggtggaaagggtggctgctggcaagaagagtctggtctccaaattgttcgat
gtgcatgcaggaaccccactgctgccctgcagcagcacagagaactcaaacgaggtgcag
gtcccctggggcaaaggcattattggctatgtcggggagcatggagaaacggtcaacatt
cctgatgcctaccaggatcgaagattcaatgacgaaatcgacaagctaactggatacaag
acgaagtcactattgtgcatgcctatccgaagcagtgacggtgagattatcggggtggcc
caagcgataaataagattcctgaaggtgctccatttactgaagatgatgaaaaagttatg
cagatgtatcttccattctgtggaatcgccatatctaatgctcaggtatttgctgcctca
aggaaagaatatgaaagaagcagggccttgttagaggtggttaatgacctctttgaagaa
cagactgacctggagaaaattgttaagaaaataatgcatcgggcccaaactctgctgaaa
tgcgagcgctgttctgttttactcctagaggacattgagtcaccagtggtgaagtttacc
aaatcctttgaattgatgtccccaaagtgcagcgccgactctgagaacagtttcaaagaa
agtgtggagaaatcatcatactccgactggctgataaataatagtgttgccgagctcgtg
gcttccacaggccttcccgtgaacatcagtgatgcctaccaggacccgcgctttgacgcc
gaggctgaccagatatctggttttcacataagatcagttctctgtgtacctatttggaat
agcagccaccaaataattggagtggctcaagtgttaaacagacttgacggaaaacctttt
gatgatgcagatcaacgactttttgaggcttttgtcatcttttgtggcctgggcatcaac
aacacaattatgtatgatcaagtgaagaagtcctgggccaagcagtccgtggctcttgat
gtgctgtcttatcatgcgacatgttcaaaagctgaagttgacaaatttaaggcagccaac
atccctttggtgtcagagcttgccattgatgacatacattttgatgacttttctctcgac
gtagatgccatgatcacagctgctcttcggatgttcatggagctggggatggtacagaaa
tttaaaattgactatgagacactgtgcaggtggcttttaacagtgaggaaaaattaccga
atggttctgtaccacaactggagacacgccttcaacgtgtgccagctgatgtttgcgatg
ttaactaccgccgggttccaggagattctgaccgaggtggaaattctagcagtgattgtg
ggatgcctgtgtcacgacctcgaccacaggggcaccaacaatgctttccaagctaagagc
ggctctgccctggcccagctctacggaacctccgccaccctagagcaccaccatttcaac
cacgccgtgatgatcctgcagagcgagggtcacaacatctttgctaatttgtcctcaaag
gaatatagtgacctcatgcagcttctgaagcagtcaatactggcaacagacctcacgctg
tactttgagaggagaactgagttctttgaacttgtcagtaaaggagaatatgactggaac
atcaaaacccatcgtgatatatttcgatcaatgttaatgacagcctgtgaccttggagcc
gtgaccaaaccgtgggagatctcgagacaggtggctgaacttgtaaccagtgagttcttc
gaacaaggagatcgggagagatcagaactcaaactcactccttcagctatttttgaccgg
aaccggaaagatgaactgcctcggttgcaactggagtggatcgatagcatctgcatgcct
ttgtatcaggccttggtgaaggtcaatgtgaaactgaagccgatgctggattcagtgtct
gcgaacagaagaaagtgggaagagttgcaccagaaaaggctactggtctcagctgccgcc
ccgtcccccgcggtggtggccggggcacacagtaactaa

KEGG   Miniopterus natalensis: 107535074
Entry
107535074         CDS       T05883                                 

Gene name
PDE8B
Definition
(RefSeq) high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107535074 (PDE8B)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107535074 (PDE8B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107535074 (PDE8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107535074 (PDE8B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107535074 (PDE8B)
SSDB
Motif
Pfam: PDEase_I PAS_9 PAS PAS_3 PAS_4 PAS_8
Other DBs
NCBI-GeneID: 107535074
NCBI-ProteinID: XP_016065879
LinkDB
Position
Unknown
AA seq 777 aa
MFSAYKVSSAEVRIGPMRLTQDPVQVLLIFAKEDSQSDGFWWACDRAGYRCNITRTPESA
LECFLDKHHEIIVIDHRQARNFDAEAVCRSIRATNLSEHTVILAVVSQASGDHEEASVLP
LLHAGFNRRFMENSSILACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDE
HVIQYVNPALERMMGYHKGELLGKELAELPKSDKNRADLLDTINTCIRKGKEWQGVYYAK
RKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTESHSF
RYKNRRRESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSP
VTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVH
QSHSHLAMPITINDVPPCIAQLLDNEESWEFNIFELEAVTHKRPLVYLGLKVFSRFGVCE
FLRCSETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAA
LIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDSKCNIFKNI
DRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEMEGSECECSPTGKNFPEN
QILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCS
IPKSQISFIDYFITDMFDAWDAFAHLPALMQHLSNNYKHWKTLDDLKCKSLRLPSDS
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgtttagtgcatataaggtttcttctgcggaggtgcgcattgggcccatgagactgaca
caggatcctgtccaggttttgctgatctttgccaaggaggatagtcagagtgatggattc
tggtgggcctgtgacagagccggttacagatgcaacatcacccggaccccggagtccgcc
ctggaatgctttctagataaacatcacgaaattattgtgatcgatcacagacaagctcga
aactttgatgcagaagctgtgtgcaggtcgatccgggccacgaatctctcagagcacacg
gtgatcctcgcggtggtttcacaagcatcaggcgaccatgaagaggcctcagtcctcccg
cttctgcacgcaggcttcaacaggagatttatggagaatagcagcatccttgcttgctat
aacgaactgattcaaatagagcacggggaagttcgctcacagttcaaattacgggcctgt
aattcagtgtttacggcattagaccactgtcatgaagccatagaaataacaagcgatgag
catgtgattcagtatgtcaacccagccttggaaaggatgatgggctaccacaagggcgag
ctcctggggaaggaacttgcggagctgcccaaaagcgataagaaccgggcagacctcctg
gacaccatcaacacgtgcatcaggaagggcaaggagtggcaaggggtttactacgccaaa
cggaagtctggggacagcatccaacagcatgtgaagatcaccccagtgatcggccaaggc
gggaaaattaggcattttgtctccctcaagaaactgtgttgtaccactgacaataataag
cagatccacaagattcatcgtgattctggagacaattctcagacagagtctcattcattc
agatacaagaacaggaggagagagtccattgatgtgaaatcaatatcatctcgaggcagt
gatgcaccaagcctacagaatcgtcgctatccatccatggcaaggatccattccatgacc
atcgaggctcccatcacaaaggttataaatataatcaacgcagcccaagaaaatagcccg
gtcacagtagcagaagccttggacagagttttagaaattttacggaccacagaactgtac
tccccacagctgggtaccaaagatgaagatcctcacaccagtgatctcgtcggaggcctt
atgactgatggcttgagaaggttgtcagggaacgagtatgtgttcactaagaacgtgcac
cagagtcacagtcaccttgcgatgccaataaccatcaacgacgtccccccttgtatcgct
cagttacttgataatgaggaaagttgggagttcaacatctttgagttggaggctgttaca
cataaaaggccgttggtttacctgggcttaaaggtcttttcccggttcggagtatgtgag
tttttacgctgttctgaaactactcttcgggcctggctccaagtgattgaagccaactac
cactcctccaatgcttaccacaactccacacacgccgcggacgtcctgcatgccacggcc
ttcttcctgggaaaggagagagtgaagggaagcctggatcagctggatgaggtggccgcc
ctgattgctgccacagtccatgacgtggatcacccgggaaggaccaactctttcctctgc
aatgcaggcagtgagcttgctgtgctctacaatgacacagctgtcctggagagccaccac
accgccctggccttccagctgaccgtcaaggacagcaagtgcaacattttcaagaacatt
gacaggaaccattatcgaacactgcgccaggctattattgacatggttttagcaacagag
atgacaaaacactttgagcatgtgaacaagtttgtgaacagcatcaacaagccaatggca
gcggagatggagggcagtgagtgcgagtgcagccctactgggaagaacttccccgagaac
cagatcttgatcaagcgcatgatgatcaagtgcgccgacgtggccaacccgtgccggccc
ctggacctgtgcatcgaatgggccgggcgcatctcggaggagtacttcgcgcagactgat
gaagagaagagacagggactgcctgtggtgatgccagtgtttgaccggaacacctgcagc
atccccaagtcacagatctccttcattgactacttcataacagacatgtttgacgcctgg
gatgcctttgcacatctgccagccctgatgcaacatttatccaataactacaaacactgg
aagacattagatgacctgaagtgcaaaagtctgaggcttccatctgacagctaa

KEGG   Miniopterus natalensis: 107535385
Entry
107535385         CDS       T05883                                 

Gene name
PDE4C
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4C
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04024  cAMP signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107535385 (PDE4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107535385 (PDE4C)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107535385 (PDE4C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107535385 (PDE4C)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107535385 (PDE4C)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 107535385
NCBI-ProteinID: XP_016066305
LinkDB
Position
Unknown
AA seq 682 aa
MQGTPAPAPAPGPGSPRDSPRSSPGLFRKLLVNQSIRLQRRFTVAHPLCFDLENAHSCKR
SALDPQVIQAPAQHSQRRESFLYRSDSDYELLPKGLSQNSSVASDLHGEDMIVTPFAQVL
ASLRTVRSNVAALAYLQGPRAPKYIGGLLTAQPPEDTGQKLALATLDELDWCLDQLETLQ
TRHSVGEMASNKFKRMLNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPGGTPTEPS
RPVSQISGLHGLPHSASLSTATIPRFGVQTDQEGQLAKELEDTNKWGLDVFKVAELSGNR
PLTAIIFSIFQKRDLLKTFQIPADTLVTYLLTLEGHYHADVAYHNSLHAADVAQSTHVLL
AMPALEAVFTDLEVLAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDTSVLENHHLAV
GFKLLQAENCNIFQNLSTRQWLSLRRMVIDIVLATDMSKHMNLLADLKTMVETKKVTSLG
VLLLDNYSDRIQVLQNLVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERDSGLDISP
MCDKHTASVEKSQVGFIDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYLSKIPRSPMD
PTSPEQGGLDRFQFELTLEEAEEEEEEEERMLAQEASESPDTELLFFEASSDPGTLCVDS
QRTVGKPCMDHEGNVLAEPFGT
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgcagggcacccccgcgcctgccccggcacctgggcctggctctccccgggactccccg
cgcagctcccccgggctcttcaggaagctcctggtgaaccagagcatccgcctgcagcgg
cgcttcaccgtggcccatcctctgtgctttgacctggaaaatgcacactcatgtaagaga
agtgccctggaccctcaggtcatccaggcccctgcccaacacagccagcggcgggagtcc
ttcctgtaccgctccgacagcgactacgaactcctgcctaagggtttgtcccagaactcc
tctgtggccagcgacctacatggagaagacatgattgtgacaccttttgcccaggtcctg
gccagtctgcggactgttcggagcaacgttgcggcgctagcctacctgcaaggcccaagg
gcacccaagtacataggggggctcctgacagctcagcccccagaggacactgggcagaag
ctggctttggcgacactggatgagctggactggtgtctggatcagctggagacactgcag
acccggcattcagtgggggagatggcttccaacaagttcaagcggatgctgaaccgggag
ttgactcacttgtctgaaaccagccgctctgggaaccaggtgtcagagtacatttcacga
accttcctggaccagcagaccgaggtggagttacctgggggaaccccaacagaaccctca
aggccagtgtcccagatcagcggcctgcatgggctcccccacagtgccagcctctccaca
gccaccatcccacgctttggggtccagactgaccaggaggggcaactggccaaggaactg
gaagacaccaataagtgggggcttgatgtgttcaaggtggcagagctaagtgggaaccgg
cccctcacagccatcatattcagcatctttcagaaacgggacctgctcaagacatttcag
atcccagcagacacacttgtcacctacctgctgacactggagggtcactaccatgccgat
gtggcctaccataacagcctgcatgccgctgatgtggcccagtccacgcatgtgctgctg
gccatgcctgcacttgaggccgtgttcacagacttggaagtcctggctgccatctttgca
agtgccatccatgatgtggaccatcctggggtctccaaccagtttctcattaacaccaac
tcggagcttgcgcttatgtacaatgacacctctgtgctggagaaccaccacctggctgtg
ggcttcaagctgctgcaggcagagaactgcaatatcttccagaacctcagcaccaggcag
tggctgagtctgcgcaggatggtcattgacatagtgttggctactgacatgtccaaacac
atgaacctcctggctgacctcaagaccatggtggagaccaagaaagtgacaagcctggga
gtcctgctgctggacaactactctgatcgcatccaggtcttgcagaacctggtgcactgt
gctgacctcagcaaccccactaagccgctgcccctgtaccgccagtggacagaccgcatc
atggctgagttcttccagcagggagaccgtgagcgagattcgggcctggacatcagcccc
atgtgcgacaagcacacagcctcagtggagaagtcccaggtgggtttcattgactacatc
gcccacccactgtgggagacatgggctgacctggtacacccagatgcacaggatctgctg
gacacactggaggacaaccgcgagtggtacctgagcaagatcccccgcagccccatggat
cccaccagccctgagcagggtggccttgacagattccagtttgagctgactctggaggag
gcagaagaagaggaggaggaggaggagagaatgttggcccaggaggcctcggagtcacct
gacactgagctcctgttcttcgaggccagctcagaccctgggaccttatgcgtagacagc
cagaggaccgtgggcaagccctgcatggaccatgagggcaatgtgctggctgagccattt
ggcacctaa

KEGG   Miniopterus natalensis: 107536128
Entry
107536128         CDS       T05883                                 

Gene name
PDE1A
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107536128 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107536128 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107536128 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    107536128 (PDE1A)
   04742 Taste transduction
    107536128 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107536128 (PDE1A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107536128 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 107536128
NCBI-ProteinID: XP_016067277
LinkDB
Position
Unknown
AA seq 514 aa
MDDHVTIKKKHLQRPIFRLRCLVKQLEKGDVNIVDLKKNIEYAASVLEAVYIDETRRLLD
TEDELGDIQSDSVPLEVRDWLASTFTQKMGIMKKKSEEKPKFRSIVHAVQAGIFVERMYR
KSYHMVGLAYPEAVIVTLKEVDKWCFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIP
VSCLIAFAETLEVGYSKYKNPYHNLIHAADVTQTVHCIMLHTGIMHWLTELEILAMVFAA
AIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLMQEEEMNVLINLSKDDW
RDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSLILHAADISHPAKCWQL
HHRWTMALMEEFFRQGDKEAELGLPFSPLCDRNSTMVAQSQIGFIDFIVEPTFSLLTDSI
EIIIIPLIEEDSKTENSYGASRRSNMKGTVNDGTYFPDYSLASVDLNSFKNNLVDIIQQN
KERWKELAAQGEPDLRKNSEGQGNAGEKCADTHS
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggatgaccatgtcacaatcaagaagaagcatctccaaagacccatctttagactaaga
tgcttggtgaagcagctggagaaaggtgatgtgaacatcgtagacttgaagaagaatatt
gaatatgcagcatctgtgttggaagccgtttatatcgatgaaacaagaagactgctggat
accgaagatgagcttggtgacatccagtcagattcggtcccactggaagtccgggactgg
ctggcttcgacctttacacagaaaatggggatcatgaaaaagaaatctgaggagaagcca
aagtttcggagcattgtgcatgctgttcaagctgggatttttgtggaaaggatgtacaga
aagtcctatcacatggttggtttggcatatccagaagctgtcatagtaacattaaaggaa
gttgataaatggtgttttgatgtatttgccttaaatgaagcaagtggagaacatagcctg
aagtttatgatttatgaactgtttaccagatacgatcttatcaaccgtttcaagattcct
gtttcttgcctaattgcctttgcagaaactttagaagttggttacagcaagtacaaaaat
ccttatcacaatctgatccacgcagcggatgtcactcaaactgtgcattgcataatgctt
catacaggcatcatgcactggctcacggaactggaaattttagcaatggtctttgccgct
gccattcacgactatgagcacacgggaaccacaaacaacttccatattcagacaaggtca
gatgttgccattttgtataacgatcgatccgtccttgaaaatcaccatgtgagtgcagct
tatcgacttatgcaagaagaagaaatgaatgtcttgataaatttatccaaagatgactgg
agggatcttcggaacctagtgattgaaatggttttgtctacagacatgtcaggtcacttc
cagcaaatcaaaaatataagaaacagtttgcagcagcccgaagggatcgacagagccaag
accatgtccctgattctccacgcagcagacatcagccacccggccaaatgctggcagctg
caccaccggtggaccatggccctgatggaggagtttttccgacagggagataaagaagct
gaattagggcttccattttccccgctctgcgatcggaactcaacgatggtggcccagtca
cagataggttttattgatttcatcgtagagccaacattttctcttctgacagactcaata
gagatcattattattcctcttatagaggaagactcaaaaacggaaaattcttacggagca
agcagacgatcgaatatgaaaggcacggtgaacgatggaacctacttcccagactactct
cttgcaagtgtggacctgaacagcttcaaaaacaacctggtggacatcatccagcagaac
aaggagagatggaaagagttagctgctcaaggtgaacctgatcttcgtaagaattcagaa
ggtcaaggaaatgctggagaaaaatgtgctgatacacattcatag

KEGG   Miniopterus natalensis: 107536599
Entry
107536599         CDS       T05883                                 

Gene name
PDE4D
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4D isoform X1
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04024  cAMP signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107536599 (PDE4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107536599 (PDE4D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107536599 (PDE4D)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107536599 (PDE4D)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107536599 (PDE4D)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 107536599
NCBI-ProteinID: XP_016067879
LinkDB
Position
Unknown
AA seq 747 aa
MKRNTCDLLSRSKSASEETLHSSNEEEGPSRGMEPYLVRRLSCRNVQLPPLAFRQLEQAD
LKSESENVQRPTSLPLKILPLIAITSADSSGFDVDNGTSSGRSPLDPMTSPGSGLILQAN
FVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFA
ALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSVS
EMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQHEVEIPSPTQKEKDKKKRPM
SQISGVRKLTHSSSLTNASIPRFGVKTEQEDVLAKELEEVNKWGLHVFRIAELSGNRPLT
VIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTP
ALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFK
LLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLL
LDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCD
KHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPD
DQEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLD
EQVEEDAVGEEESQPEACVIDDHSPDT
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgaaaagaaatacttgtgatctgctttcccggagcaaaagtgcctcagaggaaacacta
cattccagtaatgaagaggaaggcccctcacgaggcatggagccctacctggtgcggaga
ctctcgtgccgcaacgtgcagctccctcctctcgccttcagacagttggaacaagcagac
ttgaaaagtgaatctgagaacgtccaacgacccaccagcctccccctgaagattctgccg
ctgatcgctatcacttctgcagactctagtggttttgatgtggacaatggcacatcttcg
ggacggagtcccttggatcccatgaccagcccaggatctgggctaattctccaagcaaac
tttgtccacagccaacgccgggagtcgtttctgtaccgatccgacagcgactatgacctc
tctccaaagtctatgtcccggaactcctccatcgccagtgatatacatggagatgacttg
attgtgactccatttgctcaggtcttggccagcctgcgaactgtacgaaacaactttgct
gcattaactaatttgcaagatcgagcacctagcaaaagatcacccatgtgcaatcaaccg
tccatcaacaaagccaccataacagaggaggcctaccagaaactggccagcgagaccctg
gaggagctggactggtgtctggaccagctagagaccctgcagaccaggcactccgtcagt
gagatggcctccaacaagtttaaaaggatgcttaatcgggagctcacccatctctctgaa
atgagtcggtctggaaatcaagtgtcggagtatatatcaaacacattcttagacaagcag
catgaggtggaaattccttccccaactcagaaggaaaaagacaaaaagaagaggccgatg
tcccagatcagcggggtcaggaagctgacgcacagctcaagtctgaccaacgccagcatc
cccaggttcggcgtgaaaaccgaacaggaagacgtccttgccaaggaactagaagaagtg
aacaaatggggtcttcatgtgtttagaatagcagagctgtctggtaaccggcctctgact
gttatcatgcacaccatctttcaggaacgggatttattaaaaacattcaaaattccagta
gacactttaattacttaccttatgaccctggaagaccattaccatgcagacgtggcctac
cacaacaatattcatgctgcagatgtggtccagtcgacacatgtgctgttatctacacct
gctttggaggctgtgtttacagatttggagattcttgcagcaatttttgccagtgcaata
catgacgtagatcatcctggtgtgtcaaatcagtttctgatcaatacaaattctgaactt
gccttgatgtacaatgattcttctgtcttggagaatcatcatttggccgtgggctttaag
ctgcttcaagaagaaaactgtgacattttccagaacttgaccaaaaagcaaagacaatca
ttaaggaaaatggtcattgacattgtacttgcaacagacatgtcaaaacacatgaactta
ctggctgatttgaaaactatggttgaaactaagaaagtgaccagctctggagttcttctt
cttgataattattctgacaggattcaggtcctccagaatatggtgcattgtgcagacctg
agcaacccaacaaagcctctgcagctgtaccgccagtggaccgaccgcataatggaggag
ttcttccgccaaggagaccgagagagggagcggggcatggagataagtcccatgtgtgac
aagcacaatgcatctgtggaaaaatcacaggtgggcttcatagactatatcgttcatcct
ctctgggagacgtgggcagaccttgtacatcctgatgcccaggacattttggacactttg
gaggacaatcgtgaatggtaccagagcacaattcctcagagcccctccccggcacctgat
gaccaggaggagggccggcagggtcagaccgagaagttccagtttgaactcactttagag
gaggatggcgagtcagacactgaaaaggacagtggaagtcaagtggaagaagacactagc
tgcagtgactccaagactctctgtactcaagactcggagtcgaccgaaattccccttgat
gagcaggtcgaggaagatgcagtaggggaagaagaaagccagcccgaagcctgtgtgata
gatgatcattctcctgacacgtaa

KEGG   Miniopterus natalensis: 107539243
Entry
107539243         CDS       T05883                                 

Gene name
PDE8A
Definition
(RefSeq) high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107539243 (PDE8A)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107539243 (PDE8A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107539243 (PDE8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107539243 (PDE8A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107539243 (PDE8A)
SSDB
Motif
Pfam: PDEase_I PAS_9 PAS PAS_4 PAS_3 PAS_8 UBA_e1_thiolCys
Other DBs
NCBI-GeneID: 107539243
NCBI-ProteinID: XP_016071153
LinkDB
Position
Unknown
AA seq 757 aa
MRFHPDQLQVLLVFTKDDNQCKGFRKACEKAGFKYTVTREAKAVLACFLATLHDIIIIDY
RSPRQLDAELLCRSIRSYKASENTVIVGVVRKRDGDENSILPLIAAGFTRRYVENPSLLA
CYTELLQLEFGEVRSQLKLRACNSVFTALEKSQDAIEITSEDHLIQYANPAFETIMGYES
GELIGKELEKMPINEKKADLLDTINSCIKKGKEWKGVYYAKNGDNVQQNVNIIPVVGQGG
KIRHYVSIIRVSNGNNKAEKTTERVRSDTHADHQSGKHKDKRKSSLDVRSVASRASEVAS
QRRHSSMARIHSLTVETPITKVINIINAAQENSSVTVTEALDRVLEILRSTELYSPQFGA
KDDDPHANDLVGGLISDGFRRQSGNEYVLSTKALQQIPSGLILPMSLQDVPPPIAQAMEN
EQFWDFDIFKLEAATQKRPLTFLGLKIFTRFGICEFLNCSETTLRSWLQIIEANYRSSNP
YHNSTHAADVLHATAYFLCRNRIKQTLDSVDEAAALIAAAIHDLDHPGRTNPFLCNSGSE
LAILYNDIAVLESHHAALAFQLSTRDDKCNIFKNMERNDYRTLRQIIIDMVLATEMTKHF
EHFNKFVNSINKPLAELEENEEAEKDQEAINALLRTPENRTLIKRMMIKCADVSNPCRAL
EQCIEWAARISEEYFSQTDEEKQQDLPVVMPAFDRKTCSIPKSQISFIDYFITAMFDAWD
AFVDLPELLQNLDNNFKYWKGLDEMKLRGLRPPLEPE
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgagatttcatccagatcaactccaggtacttttggtgtttaccaaagacgacaaccag
tgtaaagggttccgtaaggcgtgcgaaaaggcagggttcaagtacacggttaccagggag
gcgaaggctgtgcttgcctgtttcctggctacacttcatgacatcatcatcatagactac
aggtccccccgacagttggatgcggagttgctatgcaggtctattcgatcatacaaagcc
tcagaaaacacagttatcgttggtgtggtacgcaagcgggatggagacgagaactccatt
ttacctctcatcgctgctggctttacgaggaggtatgtggaaaacccaagcctcctggcc
tgttacacagagctactccagctggagtttggagaggtgcgatcacagctgaaactcagg
gcctgcaactcagtattcaccgcgttagagaaaagccaagatgccattgaaattacaagt
gaggatcacctgattcagtatgccaatcctgcattcgaaacaataatgggctacgagtca
ggtgaattaataggaaaggagttagaaaagatgcctataaatgaaaaaaaggctgatttg
ctcgataccataaattcatgcatcaagaagggcaaggagtggaaaggcgtttactatgcc
aagaacggagacaacgtacagcaaaatgtgaacataatccctgtcgtcgggcagggagga
aaaattagacactatgtgtccattatcagagtgtccaatggcaacaataaggctgagaaa
acaaccgaacgtgttcggtctgacactcacgcagatcatcagtcaggtaaacataaagac
aagagaaaaagctcactagacgtcaggagtgttgcctctcgagcaagtgaagtggccagc
cagagacgacactcctccatggcccggatccattctttgactgtcgagacgcccatcacc
aaggtaatcaatatcatcaatgctgcccaggaaaacagctccgtgactgtcacagaagcc
ttagaccgcgtgctggaaattctaaggtccaccgagttgtactcaccacagttcggtgct
aaagatgatgatcctcacgccaatgacctcgttgggggcctgatatctgatggttttcga
agacaatctgggaatgagtatgttctgtcaacaaaagcccttcagcaaattccaagcggt
ttaatcctgcccatgtccctgcaagatgtcccgccgccgattgcgcaggccatggagaac
gagcagttctgggactttgatatttttaaactggaggctgccactcagaaaaggccttta
actttcctcggtctcaaaatctttactcgctttggaatctgtgaattcttaaactgctct
gagacaacgctgaggtcgtggctgcaaattatcgaggccaattaccgctcttctaacccc
taccacaattccacacacgctgcagacgtgctccacgccaccgcctatttcctgtgcaga
aacaggataaagcaaactttagattctgttgatgaggctgctgccctcattgcagccgcc
atccatgacctggaccaccctgggagaaccaaccccttcctgtgcaactctgggagtgag
ctggccattctgtacaatgacatcgccgtgctggagagtcaccacgcggccctggccttc
cagctgagcacgagagacgataaatgtaacatcttcaaaaacatggagaggaatgactac
cggacgctgcgccagatcatcatcgacatggtcttggccacggagatgacgaagcacttc
gagcacttcaacaagtttgtcaacagcatcaataagcccttggcagaactggaagaaaat
gaggaagctgagaaagaccaagaagccataaacgctctgctcaggactccagagaaccgg
accctgatcaaacgaatgatgatcaaatgcgcggacgtgtccaacccctgccgggccctg
gagcagtgcatcgagtgggctgcgcgcatctcggaagagtacttttctcagaccgatgaa
gaaaagcagcaggacttacctgtggtgatgccggcttttgacaggaaaacctgcagcatc
cccaagtcccagatctccttcattgactacttcatcacagccatgttcgacgcctgggac
gcctttgtagacctaccagagttactgcagaacctggacaacaattttaaatactggaaa
ggactcgatgaaatgaagctgcggggcctccgaccacctctggagccagaatag

KEGG   Miniopterus natalensis: 107541075
Entry
107541075         CDS       T05883                                 

Gene name
PDE1B
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107541075 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107541075 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107541075 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    107541075 (PDE1B)
   04742 Taste transduction
    107541075 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107541075 (PDE1B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107541075 (PDE1B)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N La_HTH_kDCL
Other DBs
NCBI-GeneID: 107541075
NCBI-ProteinID: XP_016073498
LinkDB
Position
Unknown
AA seq 535 aa
MELSPRSPPEMLESDCPSPLELKSAPSKKMWIKLRSLLRCMVKQLENGEVNIEELKKNLE
YTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQTRAKGRRAEEKPK
FRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNRAADDHALR
TIVFELLTRHNLISRFKIPTVFLMTLLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLR
TGMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVF
RMMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKSMKTALQQLERIDKSKA
LSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQ
IGFIDFIVEPTFSVLTDVAEKSVQPLVDEDSKSKSQPSFQWRQPSLDVEVGDPNPDVISF
RSTWTKYIQENKQKWKEQAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggagctgtcccctcgcagccctcccgagatgctggagtcggactgcccgtcacccctg
gagctgaagtcagcccccagcaagaagatgtggattaagcttcggtcgctgctacgatgc
atggtgaagcagctggagaatggggaggtcaacattgaggagctgaagaaaaacctggag
tacacagcctccctgctggaggccgtctacatagatgagactcggcaaatcttggacaca
gaggatgagcttcaggagcttcggtcagacgccgtgccttcggaggtgcgggactggctg
gcctccaccttcacccagcagacccgggccaaaggccgccgggcagaggagaagcccaag
ttccgcagcatcgtgcacgccgtgcaggctggcatcttcgtggaacggatgttccggaga
acgtacacctctgtgggtcccacctattccactgctgtcctcaactgtctcaagaacctg
gacctctggtgctttgatgtcttttccttgaaccgggcagcggatgaccacgctctgagg
accattgtttttgagttgctgactcggcataacctcatcagccgctttaagattcccact
gtgtttttgatgactttactggatgctttggagacaggctatgggaagtacaagaaccct
taccacaaccagatccacgcagctgatgttacccagacagtccactgctttttgcttcgc
acagggatggtgcactgcctgtcagagatcgaggtgttggccatcatctttgcagcagcc
atccacgactatgaacacacaggcactaccaacagcttccacatccagaccaagtcagaa
tgtgccatcctgtacaatgaccgctcagtgctggagaatcaccacatcagctctgttttc
cgaatgatgcaggacgacgagatgaacattttcatcaacctcaccaaggatgagtttgta
gagttgcgggccctggtcattgagatggtattggccacagacatgtcctgtcatttccag
caagtgaagtccatgaagacagccttgcagcagctggagaggattgacaagtccaaggcc
ctatctctactgctccatgctgcagacatcagccacccaaccaagcagtggtcagttcac
agccgctggaccaaggctctcatggaagaattcttccgccagggtgacaaggaggcagag
ctgggtctgcccttttccccgctgtgtgaccgtacttccactctcgtggcacagtcccag
attggtttcatcgacttcattgtggagcccacattctctgtgctgactgatgtggctgag
aagagtgtccagcccctggtggatgaagactccaagtctaaaagccagcccagcttccag
tggcgccagccttctctggatgtggaagttggagaccccaaccctgatgtgatcagcttc
cgctccacctggaccaaatacattcaggagaacaagcagaaatggaaggaacaggcagca
agtggcatcaccaaccagatgtccattgacgagctgtccccctgtgaggaggaagcccca
ccctcccctgccgaagatgaacacaaccagaatgggaatctggactag

KEGG   Miniopterus natalensis: 107544407
Entry
107544407         CDS       T05883                                 

Gene name
PDE1C
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107544407 (PDE1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107544407 (PDE1C)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107544407 (PDE1C)
  09157 Sensory system
   04740 Olfactory transduction
    107544407 (PDE1C)
   04742 Taste transduction
    107544407 (PDE1C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107544407 (PDE1C)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107544407 (PDE1C)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 107544407
NCBI-ProteinID: XP_016077780
LinkDB
Position
Unknown
AA seq 647 aa
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAAAVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SEEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPAAVIEALKDVDRWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLVHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILVNLSKDDWREFRTLVIDMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWELHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVNPLIDEPSQTAGAGQRRSSLNSLSAADPKR
SGAKSAGSEGSAAISSAVIPVDYKSFKATWTEVVHTNRERWRAKVPKEEKAKKEAEEEAR
LAAEASSQAGGGAAEQATPGEAQNQVNGARPGKGDSSRGKNSKAEKSAGEKQQNGDLKDG
KNKGDKKDPSNVGNDSKKADGTKKRSHGSPAPSASSASRLTLPGDYG
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggagtcaccgaccaaggagattgaagaatttgagagcaactctctgaaatacttgcag
ccagaacaaatcgagaaaatctggctccggctccgagggctgagaaaatataagaaaacg
tcccagaggttacggtctttggtcaaacaattagagagaggggaggcttcggtggtagat
cttaagaagaatctggaatatgcagccgcagtgcttgagtccgtgtacatcgatgaaacc
aggcgactcctggacacggaggacgagctcagcgacatccagtcagacgcggtgccttcc
gaggtccgagactggctggcctccaccttcacgcgccagatggggatgatgctgcggcgg
agcgaggagaagccgaggttcaagagcatcgtgcacgcggtgcaggccgggatattcgtg
gagagaatgtataggcggacatcaaacatggttggactgagctacccagcggcggttatt
gaagcgttaaaggacgtggacaggtggtccttcgatgtcttttccctcaatgaagccagc
ggggaccatgctctgaaattcattttctatgaattactcacacgctacgatctgatcagc
cgtttcaagatccccatttctgcactcgtctcgtttgtggaggccctggaagtgggatac
agcaagcataaaaatccttaccacaatttagtgcacgccgctgatgtcacacagacggtg
cattacctcctctacaagacgggagtcgctaactggctgacggagctggagatttttgct
ataatcttctcagctgccatccacgactacgagcacactgggaccaccaacaacttccac
atccagacccggtccgaccccgctattctgtacaacgacaggtcggtgctggaaaaccac
cacttgagtgcggcctaccgccttcttcaggacgacgaggagatgaacatcctggtcaac
ctttccaaggacgactggagggaatttcggaccttggtgattgacatggtgatggccacg
gatatgtcttgtcatttccaacagatcaaagcgatgaagacagctctgcagcagccggaa
gcgattgagaagcccaaagccttatccctgatgctgcacacggcggacatcagccatccc
gccaaggcgtgggagctccaccaccgctggaccatgtcgctgctggaggaattcttcaga
cagggggacagagaagcggagctggggctgcctttttcgcctctgtgtgacaggaagtcg
accatggttgctcagtcgcaagtaggctttatcgatttcatcgtggagcccaccttcacg
gtgctcacggacatgactgagaagatcgtgaaccccctaatcgacgagccttcccagacg
gcgggggcggggcagcggcgctcgagcctgaacagcctcagtgcggcggacccaaagcga
tcgggtgcgaagagcgctggttcggaagggagcgctgcgatcagcagtgctgtcatccct
gtcgactacaagagctttaaagccacgtggactgaggtcgtgcacaccaatcgggagcga
tggagggccaaggtgcccaaagaggagaaggccaagaaagaggcggaggaggaggcgcgc
ctggcggcggaggccagcagccaggccggtgggggcgcggccgagcaggcgacccccggg
gaggctcagaaccaggtcaacggcgcgcgccccggcaaaggcgacagctctcgtgggaaa
aactccaaagctgagaagtcggcaggagaaaagcagcagaacggtgacttgaaagatggt
aaaaataagggagacaagaaggatccatccaatgtcggaaatgactccaagaaagcagac
ggcacgaagaagcgctcgcacggctccccggcccccagcgccagctccgcgagtcgcctc
acgctgccaggggactacggataa

KEGG   Miniopterus natalensis: 107546709
Entry
107546709         CDS       T05883                                 

Gene name
PDE3B
Definition
(RefSeq) cGMP-inhibited 3',5'-cyclic phosphodiesterase B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04371  Apelin signaling pathway
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107546709 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107546709 (PDE3B)
   04024 cAMP signaling pathway
    107546709 (PDE3B)
   04022 cGMP-PKG signaling pathway
    107546709 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107546709 (PDE3B)
   04922 Glucagon signaling pathway
    107546709 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    107546709 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    107546709 (PDE3B)
   04924 Renin secretion
    107546709 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107546709 (PDE3B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107546709 (PDE3B)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 107546709
NCBI-ProteinID: XP_016080676
LinkDB
Position
Unknown
AA seq 794 aa
MILWDWDLKQWYKPHYQNSGGGSGVDLSVLNEARNMVSDLLIDPTLSPQVISSLRSISSL
MGAFSGSCRPKINPLTPFPGFYPCSEIEDPVERGDRKIHKGLHSRNSLPTPQLRRSSGAS
SLPPIEPSSRWERNNGKRPHQESGVSSQGCYLNGPFSSNPLTVPKQRSSSVSLTHHIGLR
RAGVLPSLSPVNSPGHGPVSPGSLTSRSPIEFPDTADFLTKPSVILHRSLGNAPTSPDFY
PPLRNSDSNLCNSCGHQILKYVSTPESESGTDCCGGKSGDEDNTISSKESLNLTEAQQEV
ETENRDCRKLALEDDNHLTEEAQNAQQPNIEQEASLDRVLIEDYDSLIEKMSNWNFQIFE
LVEKMGENSGRILSQVMYTLFQDTGLLEIFRIPTLQFMNYFHALENGYRDIPYHNRIHAT
DVLHAVWYLTTRPIPGLQQIHSDPGTGNETESDGRINPGRIAYISSRSCSIPDESYGCLS
SNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWSLYL
SSPEYNFLLNLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNEN
DRLLVCQVCIKLADINGPAKVRNLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRSSPQ
LAKLQESFITHIVGPLCNSYDAAGLLPGQWVEAEEEEDAESCYDDDGEESDTDEEEIEDN
LDPKPQRRKGRRRIFCQLMHHLTENHKVWKEMVEEEEKCPAEDTQPQAEGAPIPQADEIQ
VIEEADEEEERQCE
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgattctttgggattgggacttaaagcaatggtataaacctcattatcagaattctgga
ggtggaagtggagtggatctttcagtgctaaatgaggctcggaatatggtgtcagacctt
ctgattgatccgaccctttccccacaagtcatttcttcccttcgaagtatcagtagcttg
atgggtgctttctcaggttcctgtaggccaaagattaatcctctcacaccgtttcctgga
ttttacccctgctctgaaatagaggacccagtggagagaggagatcgaaaaatccacaag
ggactacacagtaggaatagtttaccaactccacagctgaggaggagctcaggagcttca
agtctgccacctattgaaccttcttcaaggtgggaacgcaataatggcaaaaggcctcac
caagaatctggtgtttcaagccaaggatgctatctaaatgggccttttagttcaaaccca
ctgacagtcccgaagcaaaggtcatcttctgtgtcgctaactcaccatataggtctaaga
agagctggtgttttaccgagcctgagtcccgtgaattctcctggccatggaccagtgtct
cctggctctctaactagtcgatcgcctatagaatttcctgatactgctgattttcttact
aagccaagtgttattttacacagatctctgggcaatgcacccacttcaccagatttttat
ccgccacttagaaattctgatagcaatttatgtaacagctgtggacatcaaatactgaaa
tatgtttcaacacctgaatcagagtctggtacagattgctgtggcgggaaatcaggggac
gaagacaacaccatttcctcaaaagaatcactcaaccttacagaagctcaacaagaagtg
gaaacagagaacagagactgcagaaaattagctctggaagatgataatcacctaacagaa
gaggcacagaatgcacagcaaccaaatattgaacaggaagcatcactggaccgggtttta
atagaagattatgattcattaatagaaaagatgagcaactggaactttcaaatttttgaa
cttgtagaaaaaatgggagagaattcaggaaggatccttagtcaggttatgtatacttta
tttcaagacactggtttattggaaatatttagaattcccactctacaattcatgaactac
tttcatgcattagaaaatggctatcgagacattccttatcacaatcgtatacacgccaca
gacgtcctacatgccgtttggtatctgacaacacggccaattcctggcttacagcagatc
cacagtgatcctggaacaggaaacgaaacagagtctgatggtagaattaaccctgggcga
attgcttacatttcttcgaggagctgctcaatcccagatgagagctatggctgcctgtct
tcaaacatccctgcgttggaattgatggctttgtacgtggcagctgccatgcacgattat
gaccacccagggcggacaaatgcatttctagtggctacaaatgcccctcaggcggtctta
tacaacgacagatctgttctggagaatcatcatgctgcatcagcttggagtctgtatctt
tctagcccagaatacaacttccttctgaacctcgatcacgtggaattcaagcgctttcgt
tttttagtcattgaagccatccttgccacagaccttaagaagcattttgatttccttgct
gaattcaatgccaaggccaatgatgtaaatagcaacggtatagaatggagtaatgaaaac
gaccgcctcttagtatgccaggtgtgcatcaaactggcagacataaacggcccagcaaaa
gttcggaacttgcatttgaaatggacagaaggcattgtcaatgaattttatgagcaggga
gacgaagaagccaatctcggtttgcccatcagccccttcatggatcgatcctctccgcag
ctggccaagctccaggagtccttcatcacacacatcgtgggccccctgtgcaactcctac
gatgctgccggtctgctcccaggccagtgggtggaagcggaagaggaggaggatgccgag
agttgttacgatgacgatggtgaagagtccgatacagatgaggaagaaatagaagacaac
ctggatcccaagccgcagagaaggaaaggcaggcggcgaatattctgccagctgatgcac
cacctcaccgagaaccacaaggtgtggaaggagatggtggaggaggaggagaagtgccca
gcggaggacactcagccgcaggcggagggcgcgcccatccctcaggccgacgagatccag
gtcatcgaggaggcggacgaagaggaggagagacagtgcgaatga

DBGET integrated database retrieval system