KEGG   Miniopterus natalensis: 107525285
Entry
107525285         CDS       T05883                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107525285 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107525285 (MGST1)
   00982 Drug metabolism - cytochrome P450
    107525285 (MGST1)
   00983 Drug metabolism - other enzymes
    107525285 (MGST1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525285 (MGST1)
   05204 Chemical carcinogenesis
    107525285 (MGST1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107525285 (MGST1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107525285 (MGST1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107525285 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107525285 (MGST1)
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107525285 (MGST1)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107525285 (MGST1)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 107525285
NCBI-ProteinID: XP_016052911
LinkDB
Position
Unknown
AA seq 155 aa
MVDLAQLMENEVFMAFASYTTIVLSKMMLMSTATAFYRMTRKAFANPEDCASFGKGENAK
KYVRVDDRVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTIA
YLLPLPQPNRALAFFVGFGVTFSMAYRLLKTRLYL
NT seq 468 nt   +upstreamnt  +downstreamnt
atggttgaccttgcccagctaatggaaaatgaagtattcatggcatttgcctcctacaca
acgatcgttctttcaaaaatgatgcttatgagcactgcaactgcattctatagaatgaca
agaaaggcttttgccaacccggaagactgtgcatcctttggcaaaggagaaaatgccaag
aagtatgttcgggtagatgacagagtagaacgcgtacgaagggcccacctgaatgatctt
gaaaatattgtgccatttcttggtattggcctcctgtattccttaagtggtccagatctc
tctacagctatcctgcacttcagactctttgtcggagcacggatctaccacacaattgca
tatttgttaccccttccccagccaaatcgtgctttagccttttttgttggatttggagtt
actttttcaatggcttacagattgctgaagactagactgtacctgtaa

KEGG   Miniopterus natalensis: 107525820
Entry
107525820         CDS       T05883                                 

Gene name
GSTA4
Definition
(RefSeq) glutathione S-transferase A4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107525820 (GSTA4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107525820 (GSTA4)
   00982 Drug metabolism - cytochrome P450
    107525820 (GSTA4)
   00983 Drug metabolism - other enzymes
    107525820 (GSTA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525820 (GSTA4)
   05204 Chemical carcinogenesis
    107525820 (GSTA4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107525820 (GSTA4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107525820 (GSTA4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107525820 (GSTA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107525820 (GSTA4)
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107525820 (GSTA4)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107525820 (GSTA4)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_2 GST_N_3 CbeA_antitoxin
Other DBs
NCBI-GeneID: 107525820
NCBI-ProteinID: XP_016053537
LinkDB
Position
Unknown
AA seq 223 aa
MAEKKPKLHYPNGRGRMETVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVE
IDGMKLVQTRSILHYIADKHNLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDEQQK
EVVSMAQKAILRYFPVFEKVLREHGQRFLVGNQLSLADIVLLQTILALEEKIPNILASFP
HLQEYTVKISNVPTIRKFLEPGSKKKPPPDEIYVRTVYNVFMP
NT seq 672 nt   +upstreamnt  +downstreamnt
atggccgagaagaagcccaagctccactatcccaacgggagaggccggatggagaccgtg
cgctgggtccttgcggccgccggagtggagtttgatgaagagtttttggaaacgaaagaa
cagttgcagaagctgcaggatggtaaccacctgctattccagcaagtgccaatggttgaa
attgacggcatgaagttggtgcagacccgaagcatcctccactacatcgcagacaagcac
aacctctttggcaaggacctcaaggagagaaccctgattgacatgtatgtggagggaacg
ctggacctgctggagctgattatcatgcaccctttcctaaagccagacgagcaacagaag
gaagtggttagcatggcccagaaggctatcctgcgatacttccctgtgtttgaaaaggtc
ctaagggagcatgggcagaggttcctggtggggaatcagctgagccttgcagacatcgtt
ctactccagaccattttggctctagaggagaaaattcccaatatcctggcttcatttcct
cacctccaggagtacacagtgaaaataagtaatgtccccacaattaggaaatttcttgaa
cctggcagcaagaagaagcctcctcccgatgagatctacgtgagaaccgtctacaacgtc
tttatgccataa

KEGG   Miniopterus natalensis: 107525824
Entry
107525824         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase alpha-4-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107525824
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107525824
   00982 Drug metabolism - cytochrome P450
    107525824
   00983 Drug metabolism - other enzymes
    107525824
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525824
   05204 Chemical carcinogenesis
    107525824
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107525824
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107525824
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107525824
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107525824
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107525824
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107525824
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_3 GST_C_2
Other DBs
NCBI-GeneID: 107525824
NCBI-ProteinID: XP_016053539
LinkDB
Position
Unknown
AA seq 222 aa
MAAKPKLWYFRGRGRMESIRWLLAAAGVEFEEEFLETREQYEKLQKDGCLLFGQVPLVEI
DGMMLTQTRAILSYLAAKYNLYGKDLKETLRINMYVDGTLDLMTMMMSIAFRPPEEREEN
IALILTKAKTRYFPVFEKILKDQGEDFLVGNKFSWADIQLLETILMVEELNASVLSDFPL
LKAFKTRISNIPTIKKFLQPGSQRKQPPDSHYVEVVRRVLHF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagccaaacccaagctctggtactttcgtggcaggggcaggatggagtcgatccgc
tggctgctggctgcggctggagtggagtttgaagaagaatttctggagacaagagaacaa
tatgagaagttgcagaaggatggatgcctgctttttggccaagtgcccctggttgaaatt
gatgggatgatgctgacacagaccagagccatcctcagctacctggctgccaagtacaac
ttgtatgggaaggacctgaaggagacactcaggatcaacatgtacgtggatggcactctg
gacctcatgacgatgatgatgtcgattgctttcaggcccccagaggaacgagaggagaac
atagctttaatcctgacaaaagctaagacccgttatttcccggtctttgaaaagattttg
aaagaccaaggagaggatttcctcgttggcaacaaattcagctgggcagacatacaattg
ttagaaactattttaatggtggaagaactgaatgcttctgttctttctgacttccctctg
ctaaaggcatttaaaacaagaatcagcaacatccctacaattaagaagttcctgcagcct
gggagccagaggaagcagcccccggacagccactatgttgaggtggtcaggcgcgttctg
catttctaa

KEGG   Miniopterus natalensis: 107525825
Entry
107525825         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase A2-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107525825
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107525825
   00982 Drug metabolism - cytochrome P450
    107525825
   00983 Drug metabolism - other enzymes
    107525825
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525825
   05204 Chemical carcinogenesis
    107525825
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107525825
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107525825
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107525825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107525825
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107525825
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107525825
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N UBM
Other DBs
NCBI-GeneID: 107525825
NCBI-ProteinID: XP_016053541
LinkDB
Position
Unknown
AA seq 166 aa
MVEIDGMKLAQSRAILNYIAAKYNLYGKDIKERALIDMYSEGMMDLNEMIMHLPLCPPDQ
KDAKLTEIKEKTTNRYFPAFEKVLKSHGQDYLVGNRLSKADIQVVELIYYVEEIDPSLLA
SFPLLKALKTRISNLPTVKKFLQPGSQRKPPIDAKMLEEAKKIFKL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggtcgaaattgatgggatgaagctggcacagtccagagccatcctcaactacattgct
gccaaatacaacctctatgggaaagacataaaggagagagccctaattgatatgtattcg
gaaggtatgatggatttgaatgaaatgatcatgcatctcccactctgcccacctgatcaa
aaagatgccaagttgaccgagatcaaagagaaaacaacaaatcgatatttccctgccttt
gaaaaagtgttgaagagccatggacaagactacctggttggcaacaggctgagcaaggcg
gacattcaagtggttgaacttatctactatgttgaagagattgaccccagccttctggcc
agcttccccctgctgaaggccctgaagaccagaatcagcaaccttccgaccgtgaagaag
tttctgcagcccggcagtcagaggaagcctcccatagatgcgaaaatgttagaagaagcc
aagaagattttcaagctttaa

KEGG   Miniopterus natalensis: 107525831
Entry
107525831         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase A2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107525831
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107525831
   00982 Drug metabolism - cytochrome P450
    107525831
   00983 Drug metabolism - other enzymes
    107525831
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525831
   05204 Chemical carcinogenesis
    107525831
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107525831
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107525831
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107525831
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107525831
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107525831
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107525831
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_3
Other DBs
NCBI-GeneID: 107525831
NCBI-ProteinID: XP_016053549
LinkDB
Position
Unknown
AA seq 222 aa
MAGKPKLHYFNGRGRMESVRWLLATAGVEFEEQFLQSPEDLEKLRKDGHLIFQQVPMVEI
DGMKLAQSRAILNYIAAKYNLYGKDIKERALIDMYSEGMMDLNEMIMHLPLCPPDQKDAK
LTEIKEKTTNRYFPAFEKVLKSHGQDYLVGNRLSKADIQVVELIYYVEEIDPSLLASFPL
LKALKTRISNLPTVKKFLQPGSQRKPPIDAKKLEEARKIFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcggggaagcccaagcttcactacttcaatggacgaggccgaatggagtccgtccga
tggctcctggccacagctggagtcgagtttgaagagcaatttttgcaaagtccagaagac
ttggaaaagttaagaaaagatggacatttgattttccagcaagtgccaatggtcgaaatt
gatgggatgaagctggcacagtccagagccatcctcaactacattgctgccaaatacaac
ctctatgggaaagacataaaggagagagccctaattgatatgtattcggaaggtatgatg
gatttgaatgaaatgatcatgcatctcccactctgcccacctgatcaaaaagatgccaag
ttgaccgagatcaaagagaaaacaacaaatcgatatttccctgcctttgaaaaagtgttg
aagagccatggacaagactacctggttggcaacaggctgagcaaggcggacattcaagtg
gttgaacttatctactatgttgaagagattgaccccagccttctggccagcttccccctg
ctgaaggccctgaagaccagaatcagcaaccttccgaccgtgaagaagtttctgcagccc
ggcagtcagaggaagcctcccatagatgcgaaaaagttagaagaagccaggaagattttc
aagttttaa

KEGG   Miniopterus natalensis: 107530448
Entry
107530448         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase theta-4-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107530448
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107530448
   00982 Drug metabolism - cytochrome P450
    107530448
   00983 Drug metabolism - other enzymes
    107530448
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530448
   05204 Chemical carcinogenesis
    107530448
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107530448
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530448
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107530448
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107530448
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107530448
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107530448
SSDB
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2
Other DBs
NCBI-GeneID: 107530448
NCBI-ProteinID: XP_016059709
LinkDB
Position
Unknown
AA seq 241 aa
MGLELYMDLLSAPCRAVYIFARKNYIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDG
KFILSESVAMLLYLCRKYSAPSYWYPPDLHTRARVDEFMAWQHTAIRLPMSKILWIKLLI
PMITGEEVSAEKTEEILTEVNRNLKLFEEKFLQDRMFITGDNISLADLVALVEMMQPMGG
NYNVFLTSSKLAEWRMRVELTIGSNLFWEAHNRLVKLAEWDCSTLDPMVKDRISEMLRKF
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacatggacctgctgtcagcgccctgccgtgccgtttatatcttt
gccaggaagaactacatcccctttgacttccagtttgtggacctgctgaaaggtcaccac
cacagcaaggagtacattgaaatcaaccccctgaggaagctgcccagcctcaaagacgga
aaatttatcttatctgaaagcgtggccatgctcctctacctgtgccgcaagtacagcgcg
ccctcctactggtacccgccagacctgcacacgcgcgcccgcgtggatgagttcatggcc
tggcagcacacggccattcggctgcccatgagcaagatactctggatcaagctgctgatc
ccaatgatcacaggtgaagaggtttcagctgagaagacagaggagatattaacagaggtg
aatcgaaacctgaagctgttcgaggagaagtttctgcaggacaggatgttcatcactggg
gacaacatctcactggctgacttggtggccctggtggagatgatgcagccgatggggggc
aactacaatgtcttccttaccagctccaagctggccgaatggcgcatgagggtggaacta
accattggctctaacctcttctgggaggcccacaaccggctggtgaagttggcagagtgg
gactgttcaacattggatccgatggtcaaagacaggatcagtgagatgctgcgcaagttc
acgtag

KEGG   Miniopterus natalensis: 107530525
Entry
107530525         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107530525
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107530525
   00982 Drug metabolism - cytochrome P450
    107530525
   00983 Drug metabolism - other enzymes
    107530525
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530525
   05204 Chemical carcinogenesis
    107530525
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107530525
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530525
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107530525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107530525
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107530525
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107530525
SSDB
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4
Other DBs
NCBI-GeneID: 107530525
NCBI-ProteinID: XP_016059788
LinkDB
Position
Unknown
AA seq 240 aa
MGLELYLDLLSQPCRAVYIFAKKNGIPLELRTVELLKGQHLSDAFAQVNPLKKVPTLKDG
DFTLTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKTMF
PDFLGEPVSPKTLAATLAELDVTLQILEDKFLQNKAFLAGPHISLADLVAITELMHPVGA
GCQIFEGRPKLAAWRQRVEAAVGSVLFQEAHEVILKAKNFPLPDPVLKQKLMPRVLAMIQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtcgcagccctgccgcgccgtctacatcttc
gccaagaagaacggcatccccttggagctgcgcaccgtggagctgctcaaaggccagcac
ctcagcgatgcctttgcccaggtgaaccccttgaagaaggtccctaccctgaaggatggg
gactttaccttgacagagagtgtggccatcctgctctacctgacacgcaagtataaggtc
ccagaccactggtaccctcaggacctgcaggctcgtgcccgtgtggatgagtatctggca
tggcagcacacgaccctgcggagaagctgcctccggaccctgtggcataagacaatgttt
cctgatttcctgggtgagccggtatctcccaagacgctggcggccacactggcagagttg
gatgtgaccctgcagatacttgaagacaagttcctccagaacaaggcctttctcgcaggg
ccccacatttccctggctgacctagtagccatcacggagctgatgcatcccgtgggtgct
ggctgccaaatctttgaaggccgacccaagctggctgcatggcgccagcgcgtggaggca
gcagtggggtcagtcctcttccaggaggcccatgaggtcatcttgaaggccaagaacttt
ccacttccagaccctgtcttaaagcagaagctgatgcctagggtgctagccatgatccaa
tga

KEGG   Miniopterus natalensis: 107530526
Entry
107530526         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase theta-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107530526
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107530526
   00982 Drug metabolism - cytochrome P450
    107530526
   00983 Drug metabolism - other enzymes
    107530526
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530526
   05204 Chemical carcinogenesis
    107530526
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107530526
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530526
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107530526
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107530526
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107530526
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107530526
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Other DBs
NCBI-GeneID: 107530526
NCBI-ProteinID: XP_016059789
LinkDB
Position
Unknown
AA seq 239 aa
MVLELYLDLMSQPCRAVYIFAKKNGIPFELRTVSPTGQHHSDAFAQVNPLRKVPALKDGD
FTLAESVAILLYLCRKYETPDHWYPQDLQARARVDEYLAWQHTALRSSCTRAMWQKMMIP
VFLGERVPPETLASTLAELDRCLQLLEDKFLKDKDFLAGPHISVADLMAITELMHPVSAG
CHIFKSRPKLAAWRQRVEAAVGEDLFQEAHEVVMKAKDLPPADTAVKEKLKPLVQVLLQ
NT seq 720 nt   +upstreamnt  +downstreamnt
atggtcctggagctctacctggacctgatgtcgcagccctgccgcgccgtctacatcttc
gccaagaagaacggcatccccttcgagctgcgcaccgtctctcccacaggtcagcaccac
agcgatgcctttgcccaggtgaaccccctgaggaaggtgccagccttgaaggatggggac
ttcaccttggctgagagtgtggccatcctgctgtatctctgccgaaagtatgagactccc
gaccactggtacccccaggacctgcaggcccgcgctcgtgtggatgagtacttggcatgg
cagcacacggctctgcgaagtagctgcacccgggccatgtggcagaagatgatgatacca
gtgttcctgggtgaacgggtgccccctgagacgttggcatctactctggccgagttggac
aggtgcctgcagctgcttgaggacaaattcctaaaggataaagacttccttgctgggccc
cacatctcagtggctgacttgatggccatcacagagctgatgcatcccgtcagcgctggc
tgccatatcttcaaaagccgacccaagctggctgcctggcgccagcgtgtggaggcggcg
gtgggggaggacctcttccaggaggctcacgaagttgtcatgaaggccaaggacctgcct
ccagcagacactgctgtgaaagagaagctgaagcccttggtgcaggttttgttgcagtga

KEGG   Miniopterus natalensis: 107530527
Entry
107530527         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase theta-2B-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107530527
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107530527
   00982 Drug metabolism - cytochrome P450
    107530527
   00983 Drug metabolism - other enzymes
    107530527
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530527
   05204 Chemical carcinogenesis
    107530527
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107530527
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530527
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107530527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107530527
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107530527
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107530527
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5
Other DBs
NCBI-GeneID: 107530527
NCBI-ProteinID: XP_016059790
LinkDB
Position
Unknown
AA seq 244 aa
MVLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHRNKEFLPVNSLQRVPVLKDG
DFVLSESVAILIYLSCKYQTADHWYPSDLQARMRIHEYLGWHADRIRSTFGVSLWAQVLA
PLIGVQLPEEKLKRNRTAVDQALQHLEDKFLGDKAFLTSQQVTLADLMALEELMQCVAVG
YDVFAGRPRLAAWHKRVKAFLGTDLWQETHEYILNILELAANKKLPQPSPEAYANMMLRI
SRIP
NT seq 735 nt   +upstreamnt  +downstreamnt
atggtcctggagctctacctggacctgctgtcgcagccctgccgcgccgtctacatcttc
gccaagaagaacggcatccccttcgagctgcgcaccgtggaactgctcaaaggacagcac
cggaacaaggagttcttaccagttaatagtctgcagagggttcctgtcctcaaggatggt
gactttgtcttgagcgaaagcgtggccatcctgatttacctgagctgtaagtaccagacg
gcggaccactggtacccatctgacctgcaggcccgcatgcgtatccatgagtacctgggc
tggcatgctgaccgtatccgtagcacctttggtgtgtccctgtgggcccaggtgctggca
ccgctcattggggttcagctgccagaggagaagttgaagcgcaataggaccgctgtggac
caggcgctgcagcacctggaggacaagttcctgggggacaaggccttcctcactagtcag
caggtgacgctggctgacctcatggcactggaggagctgatgcagtgcgtggctgttggc
tatgatgtgtttgcaggacggccacgactggctgcatggcataagcgcgtgaaggctttc
ctgggtactgatctgtggcaggagacacatgagtacatcttgaacatcctggaactggcg
gccaacaaaaaactcccgcagccttcccctgaagcctatgcaaatatgatgcttcgtatt
tccaggatcccctga

KEGG   Miniopterus natalensis: 107534914
Entry
107534914         CDS       T05883                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107534914 (MGST2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107534914 (MGST2)
   00982 Drug metabolism - cytochrome P450
    107534914 (MGST2)
   00983 Drug metabolism - other enzymes
    107534914 (MGST2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534914 (MGST2)
   05204 Chemical carcinogenesis
    107534914 (MGST2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107534914 (MGST2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107534914 (MGST2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107534914 (MGST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107534914 (MGST2)
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107534914 (MGST2)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107534914 (MGST2)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 107534914
NCBI-ProteinID: XP_016065672
LinkDB
Position
Unknown
AA seq 146 aa
MAGNSILLAAVSVLSACQQSYFALHVGKARLKYKVMPPAVSGSPEFERIFRAQQNCVEFY
PLFMITLWMAGWYFNQVFATCLGLVYIYARHQYFWGYSEAANKRMTGFQLSLGILALLTV
LGALGIANSFLDEYLDLNIAKKLRHF
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcggggaactcaatcctgctggccgccgtctctgtcctctctgcctgtcagcaaagt
tatttcgctttgcatgtaggaaaagcaagattaaaatacaaagttatgcccccggcagtc
tctgggtcaccagagtttgagagaatatttcgtgcacaacaaaactgtgtggagttttac
cccctattcatgattacactgtggatggcaggatggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatatatgcccgtcaccagtacttctggggatactcggaagct
gctaataaaaggatgactggtttccagttgagtctggggattttggccttgttgaccgtc
ctaggagccctggggattgcaaacagctttctggatgagtacctggacctcaatattgcc
aagaaactgaggcacttctaa

KEGG   Miniopterus natalensis: 107536433
Entry
107536433         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase omega-2-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107536433
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107536433
   00982 Drug metabolism - cytochrome P450
    107536433
   00983 Drug metabolism - other enzymes
    107536433
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536433
   05204 Chemical carcinogenesis
    107536433
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107536433
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107536433
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107536433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107536433
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107536433
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107536433
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Glutaredoxin
Other DBs
NCBI-GeneID: 107536433
NCBI-ProteinID: XP_016067599
LinkDB
Position
Unknown
AA seq 316 aa
MSLQVRLSYLACVPDPLPAVPPEPCPLNTESGQVGRRTGACGCGCEPRGHRICDTPGRCC
VECRSLSRYLENMTENESKTLGKGSVPPGPVPEGLIRVYSMRFCPFAHRTRLVLLAKGIR
HEVININLRNKPDWYYTKHPFGQIPVLENSKCQLIYESVIACEYLDDAYPGRKLYPYDPY
ERARQKMLLELFYKVPHLTKECLVALRCGKECYDLKLALREEFCNLEEILSYQNTIFFGG
DCISMIDYLFWPWFERLDVYGIADCVNHTPALRLWIEAMKQDPTVCALLIDKNIFLGFLN
LYFQNNPNAFDFGLSS
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtctctccaggttaggttatcctacctagcttgtgtcccagatcccttgcccgctgtc
ccaccagagccctgtcccttaaacactgaatctgggcaggtggggcggcgcaccggagcc
tgcggctgcggctgcgagccccggggccaccgcatctgcgataccccgggccgctgctgc
gtggagtgtaggtcgctgagcaggtacctggaaaacatgactgagaatgagagcaagacc
ttggggaaaggaagtgtccccccagggccggtcccagagggcctgatccgtgtctacagc
atgaggttctgtcccttcgcgcacaggactcgcttggtccttctggccaaaggcatcaga
catgaagttatcaacattaacctgagaaataagcctgactggtactatacaaagcaccct
tttggccaaattcctgtcctggaaaatagcaaatgtcagctgatctacgaatctgtgatc
gcttgtgagtacctggatgatgcttatcctggaaggaagctgtatccatatgacccctat
gagcgagctcgccaaaagatgttattggagctattctataaggtcccacatttgaccaag
gagtgcctggtagcattgagatgcgggaaagaatgctatgatctgaagctagcccttcgt
gaggaattctgcaaccttgaagagattcttagctatcagaacaccatcttctttggtgga
gactgtatctccatgattgattacctcttttggccctggtttgagcggctggatgtatat
ggaatagctgactgtgtgaaccacaccccagcacttcggctctggatagaggccatgaag
caggaccccacggtgtgtgctcttctcatagataagaacattttcctgggcttcttgaat
ctctattttcagaacaaccccaatgcctttgactttgggcttagttcttga

KEGG   Miniopterus natalensis: 107536478
Entry
107536478         CDS       T05883                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107536478 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107536478 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    107536478 (GSTO1)
   00983 Drug metabolism - other enzymes
    107536478 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536478 (GSTO1)
   05204 Chemical carcinogenesis
    107536478 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107536478 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107536478 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107536478 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107536478 (GSTO1)
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107536478 (GSTO1)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107536478 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Other DBs
NCBI-GeneID: 107536478
NCBI-ProteinID: XP_016067681
LinkDB
Position
Unknown
AA seq 213 aa
MRFCPFAQRTLLVLKAKGIRHEIININLKNKPEWFFKKNPAGLVPVLENSQGQLICESAI
TCEYLDEAYPGKKLLPDDPYEKACQKMVFELFSKIPSLVGSFIRSKTEEDRSGLKEEFCK
EFSKFEEVLTNKKTTFFGGNSLSMIDYLIWPWFQRLEALELNECVDHTPKIKLWMAAMRE
DPAVSALWIDVKAYRGFLNLYLQDSREACDYGL
NT seq 642 nt   +upstreamnt  +downstreamnt
atgcggttctgcccgttcgcgcagaggacgctcctcgtgctcaaggccaaggggatccgg
catgaaatcatcaacatcaacctgaagaataagcctgagtggttctttaagaagaatccc
gctggtctggtgccagttctggaaaatagtcaaggtcaactgatctgcgaatctgccatc
acttgtgagtacctggatgaagcatatccagggaagaagctgttgccagatgatccctat
gagaaggcatgccaaaagatggtctttgagctgttttctaagataccatctttggtggga
agctttattagaagtaaaactgaagaagaccgctctggcctgaaagaagaattttgtaaa
gaattcagcaagtttgaggaggttttgaccaataagaagacaaccttcttcggtggcaat
tccctttctatgattgattacctcatctggccctggtttcaacggctggaagcactggag
ttaaatgagtgtgtagaccacactccaaaaattaagctctggatggcagccatgagggag
gaccctgcagtatcagccctctggattgatgtgaaggcctatcgaggtttcctaaatctc
tacttgcaggacagcagggaggcctgtgactatgggctctga

KEGG   Miniopterus natalensis: 107537398
Entry
107537398         CDS       T05883                                 

Gene name
GSTP1
Definition
(RefSeq) LOW QUALITY PROTEIN: glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05215  Prostate cancer
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107537398 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107537398 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    107537398 (GSTP1)
   00983 Drug metabolism - other enzymes
    107537398 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537398 (GSTP1)
   05204 Chemical carcinogenesis
    107537398 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107537398 (GSTP1)
   05215 Prostate cancer
    107537398 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107537398 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107537398 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107537398 (GSTP1)
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107537398 (GSTP1)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107537398 (GSTP1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N
Other DBs
NCBI-GeneID: 107537398
NCBI-ProteinID: XP_016068895
LinkDB
Position
Unknown
AA seq 195 aa
MEHCEATHMLLADQGQSWKEEVVTMDTWLQGXLKASCLYGQVPKFQDGDLTLYQSNAILC
HLGCSLGLYSKDQWEVAAVDMVNDGWRTSRSSVATSSEEGKAQYVQELPGHLKPFETLLT
QNQGDQAFVMGDQISFANXDLLDLLLNHQILVPGCLHTLPLLSSYMARLRARPKLKAFLA
SPXHLNCPISGAQKI
NT seq 588 nt   +upstreamnt  +downstreamnt
atggagcactgcgaggccacgcacatgctgctggctgaccagggccagagctggaaggag
gaggtggtgaccatggacacctggctgcagggtntactcaaagcctcctgtctgtatggg
caggtccccaagttccaggacggagacctgaccctgtaccagtccaatgccatcctgtgc
cacctgggctgctcccttgggctctacagcaaagaccagtgggaggtggccgccgtggac
atggtcaatgacggttggaggacctcccgaagctctgtggccacctcctctgaggaaggc
aaagcccagtatgttcaggagctgccggggcacctgaagcctttcgagactctgctgacc
cagaaccagggggaccaggccttcgtcatgggcgaccagatctccttcgccaactaggac
ctgctggacctgctgctgaatcaccagatcctggtccctggctgcctgcacaccctcccc
ctgctctcctcctacatggctcgcctcagagcccggcccaagctcaaggccttcctggcc
tccccctagcacctgaactgccccatctctggagcccaaaagatatga

KEGG   Miniopterus natalensis: 107537399
Entry
107537399         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05215  Prostate cancer
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107537399
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107537399
   00982 Drug metabolism - cytochrome P450
    107537399
   00983 Drug metabolism - other enzymes
    107537399
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537399
   05204 Chemical carcinogenesis
    107537399
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107537399
   05215 Prostate cancer
    107537399
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107537399
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107537399
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107537399
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107537399
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107537399
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3
Other DBs
NCBI-GeneID: 107537399
NCBI-ProteinID: XP_016068896
LinkDB
Position
Unknown
AA seq 212 aa
PAVAPYTITYFHARGRCEAMRMLLADQGQSWKEEVVTLDTWLQGSLKASCLYGQLPKFQD
GDLTLYQSNAILRHLGRSLGLYGKDQREAALVDVVNEGVEDLRRKYCTLIYTNYEAGKED
YVKELPGQLKPFETLLSQNQGGQAFIVGNQISFTDYNLLDLLLNHQVLAPGCLDAFPLLS
SYVARLSSRPKLKAFLASPEHVNRPINGNGKQ
NT seq 639 nt   +upstreamnt  +downstreamnt
cctgcagtggcgccttacaccataacctacttccatgctcgagggcgctgcgaggccatg
cgcatgctgctggccgaccagggccagagctggaaggaggaggtggtcaccctggacacc
tggctgcagggctctctcaaggcctcgtgtctgtacggacaactccccaagttccaggac
ggagacctgaccctgtaccagtccaatgccatcctgcgccacctgggccgctccctaggg
ctgtacgggaaggaccagcgggaggccgccctggtggacgtggtgaacgagggcgtggag
gacctccgccgcaagtactgcaccctcatctacaccaactacgaggcgggcaaggaggac
tatgtgaaggagctgccggggcaactgaagccttttgagaccctgctctcccagaatcag
gggggccaggcctttattgtgggcaaccagatctccttcactgactacaacctgctggac
ctgctgctgaaccaccaggtcctggcccccggctgcctggacgccttccccctgctctcc
tcctacgtggctcgcctcagctcccggcccaagctcaaggccttcctggcctcccccgag
catgtgaaccgccccatcaatggcaatgggaaacagtga

KEGG   Miniopterus natalensis: 107537949
Entry
107537949         CDS       T05883                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107537949 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107537949 (MGST3)
   00982 Drug metabolism - cytochrome P450
    107537949 (MGST3)
   00983 Drug metabolism - other enzymes
    107537949 (MGST3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537949 (MGST3)
   05204 Chemical carcinogenesis
    107537949 (MGST3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107537949 (MGST3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107537949 (MGST3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107537949 (MGST3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107537949 (MGST3)
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107537949 (MGST3)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107537949 (MGST3)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 107537949
NCBI-ProteinID: XP_016069559
LinkDB
Position
Unknown
AA seq 152 aa
MAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSMDPENGHLFNCIQRA
HQNTLEVYPPFLFFLAVGGVYHPRVVSGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI
ALLGLMGTTVCSAFQHLGWVKTGLGSGSKCCH
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccgtcctctccaaggagtatgggttcgtggttctgaccggggccgccagcttcatc
atggtggctcacctggccatcaacgtctccaaggcccgcaagaagtacaaggtggagtat
cccaccatgtacagcatggaccctgagaatgggcacctcttcaactgcatccagcgagcc
caccaaaacacgttagaagtgtacccgcctttcttattcttcctagctgtgggaggtgtg
taccacccgagagtagtttcgggcttgggcttggcctggattgttggacgagttctctat
gcctatggctactacacaggagaacccagcaagcggagcagaggagccctgggctccatc
gccctccttggcttgatgggcacaactgtgtgctctgccttccagcatctgggctgggtt
aagactggcttgggcagtgggtccaaatgctgccattaa

KEGG   Miniopterus natalensis: 107545231
Entry
107545231         CDS       T05883                                 

Definition
(RefSeq) glutathione S-transferase Mu 1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107545231
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107545231
   00982 Drug metabolism - cytochrome P450
    107545231
   00983 Drug metabolism - other enzymes
    107545231
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545231
   05204 Chemical carcinogenesis
    107545231
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107545231
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107545231
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107545231
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107545231
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107545231
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107545231
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_C_6 GST_N_3 WD40_alt
Other DBs
NCBI-GeneID: 107545231
NCBI-ProteinID: XP_016078758
LinkDB
Position
Unknown
AA seq 211 aa
MAAWDSCCSHPRGKGGWCRGCFLHSIFSTTAPDYDRSQWLSEKFKLGLDFPNLPYLIDGA
HKLTQSNAILRYIARKHNLCGETEQEKIYVDILENEIMDLRMYNIRTSYSPDFEKQKVEF
LKVVPEKMKLFSQFLGKRSWFAGDKLTYVDFLAYDLLDVLRMFEPKCLDAFPNLKDFMAR
FEGLKKISAYMKSSRFRRTPVYSKAAMWGNK
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctgcctgggattcctgctgctcccaccccagagggaaagggggctggtgtcgggga
tgtttccttcactccatcttctccaccacagctccggactatgacagaagccagtggctg
agtgagaaattcaagctgggcctggacttccccaatctgccctacttaattgacggggcc
cacaagctcacccagagcaacgccatccttcgctacattgctcgaaagcacaacctctgt
ggggagacagaacaggagaagatttatgtggacattttggagaacgagattatggacctc
cgaatgtacaacattaggaccagctacagccctgactttgagaaacagaaagttgagttt
ttgaaggtggtccctgaaaagatgaagctcttctcacagtttctgggcaagaggtcttgg
tttgcaggggacaagctcacctacgtggatttcctggcttatgacttactggatgtgctg
cgaatgtttgagcccaagtgcctggatgcgttcccgaacctgaaggacttcatggcccgc
tttgagggcctgaagaagatctccgcctacatgaagtccagccgcttccgccgaacaccc
gtgtactccaaggccgccatgtggggcaacaagtag

KEGG   Miniopterus natalensis: 107545232
Entry
107545232         CDS       T05883                                 

Gene name
GSTM3
Definition
(RefSeq) glutathione S-transferase Mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna00982  Drug metabolism - cytochrome P450
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna01524  Platinum drug resistance
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05225  Hepatocellular carcinoma
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107545232 (GSTM3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107545232 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    107545232 (GSTM3)
   00983 Drug metabolism - other enzymes
    107545232 (GSTM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545232 (GSTM3)
   05204 Chemical carcinogenesis
    107545232 (GSTM3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107545232 (GSTM3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107545232 (GSTM3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107545232 (GSTM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107545232 (GSTM3)
Enzymes [BR:mna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107545232 (GSTM3)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107545232 (GSTM3)
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_C_6
Other DBs
NCBI-GeneID: 107545232
NCBI-ProteinID: XP_016078759
LinkDB
Position
Unknown
AA seq 222 aa
MSSKSMVLGYWDIRGTLPRPSLRRDTEEAGSHCVLSLAAPDYDRSQWLDVKFKLDLDFPN
LPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRLQLVRLCYHSD
HEKLKPQYLDQLPGQLRQFSLFLGKFSWFAGEKLTFVDFLTYDVLDQNRMFEPKCLDEFP
NLKAFMCRFEALEKIATYMQSDRFFKMPINNKMAQWGNNRLC
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtcgtctaagtctatggttctgggttactgggatattcgcgggacccttccacggccc
tccctccggcgggacaccgaggaggccgggtcccactgcgtcctctctcttgcagctcct
gactatgacagaagccaatggctggatgtgaaattcaagctagacctggactttcctaac
ctgccctacctcatggatggcaagaacaagatcacccagagcaacgccatcctgcgctac
atcgcgcgcaagcacaatatgtgtggcgacactgaagaagaaaagattcgcgtggacatc
atggagaaccagataatggatttccgcttgcagctggttcgactctgctaccactcggac
catgaaaaattgaagcctcagtacctggaccagctaccgggacaactgagacaattctcc
ttgttcctagggaaattctcctggtttgcaggggaaaagctcaccttcgtggatttcctc
acctatgacgtcttggatcagaaccgtatgtttgagcccaagtgcctggatgaatttcca
aatctgaaggctttcatgtgccgctttgaggctttggagaagatcgctacctacatgcag
tctgaccgcttcttcaagatgcccatcaacaacaagatggcccagtggggcaacaacaga
ctgtgctga

DBGET integrated database retrieval system