KEGG   Miniopterus natalensis: 107525331
Entry
107525331         CDS       T05883                                 

Gene name
GRIN2B
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2B
  KO
K05210  glutamate receptor ionotropic, NMDA 2B
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
mna05034  Alcoholism
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107525331 (GRIN2B)
   04015 Rap1 signaling pathway
    107525331 (GRIN2B)
   04024 cAMP signaling pathway
    107525331 (GRIN2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107525331 (GRIN2B)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107525331 (GRIN2B)
   04728 Dopaminergic synapse
    107525331 (GRIN2B)
   04720 Long-term potentiation
    107525331 (GRIN2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107525331 (GRIN2B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107525331 (GRIN2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107525331 (GRIN2B)
   05014 Amyotrophic lateral sclerosis
    107525331 (GRIN2B)
   05016 Huntington disease
    107525331 (GRIN2B)
   05017 Spinocerebellar ataxia
    107525331 (GRIN2B)
   05020 Prion disease
    107525331 (GRIN2B)
   05022 Pathways of neurodegeneration - multiple diseases
    107525331 (GRIN2B)
  09165 Substance dependence
   05030 Cocaine addiction
    107525331 (GRIN2B)
   05031 Amphetamine addiction
    107525331 (GRIN2B)
   05033 Nicotine addiction
    107525331 (GRIN2B)
   05034 Alcoholism
    107525331 (GRIN2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107525331 (GRIN2B)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107525331 (GRIN2B)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 107525331
NCBI-ProteinID: XP_016052965
LinkDB
Position
Unknown
AA seq 1385 aa
MKPRAECCSPKFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGCGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYLWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIVSENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAI
LQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
LFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFS
DYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFPTQPRPAGK
KPLDLGLPAAKHGPLGDLYGKFSFKSDRYGGHDDLIRSDVSDISTHTVTYGNIEGNAAKR
RKQQYKDSLKKRPASAKSRRELDEIELAYRRRPRSPDHKRCFRDKEGLRDFYLDQFRPKE
NSPHWEHVDLTDLYKERSDSVGGGGPCANRPHLKHAYPQSPTNSKAQKKNRNKLRRQHSY
DTFVDLQKEEAALAPRSVSLKDKGRFVEGSPYAHMFEMPAGESAFANSKSSVPTAGHHHH
HHSNNPGGGGGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPSVPGAPKARP
DFRALVTNKPVVSALHGAVQGRFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSS
IESDV
NT seq 4158 nt   +upstreamnt  +downstreamnt
atgaagcccagagcagagtgctgttctcccaagttctggttggtgttggctgtcctggcc
gtgtcaggcagcagagctcgttctcagaagagcccccccagcattggcattgctgtcatc
ctcgtgggcacttcagacgaggtggccatcaaggatgctcacgagaaagatgacttccat
catctctccgtggtgccccgtgtggagctagtagccatgaatgagactgatccaaagagc
atcatcacccgtatctgcgatctcatgtctgatcggaagatccagggggtggtgtttgct
gacgacactgaccaggaagccatcgcccagatccttgacttcatttcagcccagactctc
acccccatcctgggcatccacgggggatcctctatgataatggcagataaggatgagtct
tccatgttcttccagtttggcccatcgattgaacagcaagcctccgtaatgctcaacatc
atggaagagtatgactggtacatcttttctatcgtcaccacctacttccctggctaccag
gactttgtgaacaagattcgcagcaccattgagaatagctttgtgggctgggagttggag
gaagtcctcttgctggacatgtccctggatgatggagattctaagattcagaaccagctc
aagaaacttcaaagtcccatcattcttctttactgtactaaggaagaggccacctacatc
ttcgaagtcgctaactcagtagggctgaccggctgcggctacacgtggattgtgcctagt
ctggtggcaggggatacggacacggtgccctcggagttccccacggggctcatctcagtg
tcctatgatgaatgggactatggcctccctgccagagtgagggatggaattgccataatc
accaccgctgcttccgacatgctgtctgagcacagcttcatcccggagcccaagagcagc
tgctacaacacccacgagaagcggatctaccagtccaacatgctgaataggtatctgatc
aatgtcacttttgaggggagaaatctgtccttcagtgaagatggctaccagatgcacccg
aaactggtgataatccttctgaacaaggagaggaagtgggagagggtggggaaatggaaa
gacaagtctctgcagatgaagtactacttgtggccccgaatgtgtcctgagacagaagag
caggaggatgaccatctgagcatcgtaaccctggaggaagctccgtttgttattgtggag
agtgtggaccctctgagtggaacctgcatgaggaacacagtcccctgtcaaaaacgcatc
gtctctgagaataaaacagatgaagagccaggttacatcaaaaaatgctgcaagggcttc
tgtattgacatccttaagaaaatctccaaatctgtgaagttcacctatgacctttacctg
gtcaccaatggcaagcatgggaagaaaatcaacggaacctggaatggtatgattggagag
gtggtcatgaagagggcctacatggcagtggggtcgctcaccatcaatgaggagcgatct
gaggtggtcgacttctctgtgcccttcatagagactggcatcagtgtcatggtgtcacgc
agcaatgggaccgtctcaccttctgccttcttagagcccttcagcgctgacgtgtgggtt
atgatgtttgtgatgctgctcattgtctcagctgtggccgtctttgtctttgagtacttc
agccctgtgggttacaacaggtgcctcgccgatggtagagagccaggtggcccgtctttt
accatcggcaaagctatttggttactctggggtctggtgtttaacaactccgtcccggtg
cagaacccaaaggggaccacctccaagatcatggtgtcagtgtgggccttctttgctgtc
atcttcctggccagctacactgccaacttagctgccttcatgatccaagaggagtatgtg
gaccaggtttccggcctgagtgacaaaaagttccagagacctaatgacttctcaccccct
tttcgcttcgggacggtgcccaatggcagcacagagaggaatattcgcaataactacgca
gaaatgcatgcttacatgggaaagttcaaccagaggggtgtcgatgatgcgttgctctcc
ctgaaaacagggaagctggatgccttcatctatgatgcagcagtgctaaactacatggca
ggcagagatgaaggctgcaagctggtgaccattggcagcgggaaggtcttcgcttccact
ggttatggcattgccatccaaaaagattctgggtggaagcgccaggtggaccttgctatc
ctacagctcttcggagatggggagatggaggagctggaagctctctggctcactggcatt
tgccacaatgagaagaatgaggtcatgagcagccagctggacattgataacatggcagga
gtcttctacatgttgggggcagccatggctctcagcctcatcaccttcatctgtgaacac
cttttctattggcagttccggcactgctttatgggcgtctgttccggcaagcctggcatg
gtcttctccatcagcagaggcatctacagctgcatccacggggtggccatcgaggagcgc
cagtcggtgatgaactcgcccaccgccaccatgaacaacacgcactccaacatcctgcgc
ctgctgcgcacggccaagaacatggccaacctgtcgggcgtgaacggctccccgcagagc
gcgctggacttcatccgccgcgagtcgtccgtgtacgacatctccgagcaccgccgcagc
ttcacgcactcggactgcaagtcctacaacaacccgccgtgcgaggagaacctcttcagc
gactacatcagcgaggtggagaggactttcgggaacctgcagctgaaggacagcaacgtg
taccaggaccactaccaccaccaccaccggccgcacagcatcggcagcgccagctccatc
gacgggctgtacgactgcgacaacccgcccttccccacgcagccgcggcccgcgggcaag
aagccgctggacctcggcctgcccgccgccaagcacggcccgctgggcgacctgtacggc
aagttctccttcaagagcgaccgctacggcggccacgacgacctcatccgctccgacgtg
tcggacatctccacgcacacggtcacctacggcaacatcgagggcaacgcggccaagcgg
cgcaagcagcagtacaaggacagcctcaagaagcggcccgcgtccgccaagtcgcggcgc
gagctggacgagatcgagctggcctaccggcgccggccgcgctcgcccgaccacaagcgc
tgcttccgggacaaggaggggctgcgcgacttctacctggaccagttccgccccaaggag
aactcgccgcactgggagcacgtggacctgaccgacctctacaaggagcgcagcgactcg
gtgggcgggggcgggccctgcgccaacaggccgcacctcaagcacgcgtacccgcagagc
cccactaactccaaggcccagaagaagaaccgcaacaagctgcgccggcagcactcctac
gacaccttcgtggacctgcagaaggaagaagccgccctggccccgcgcagcgtgagcctc
aaggacaagggccggttcgtggaggggagtccctacgcccacatgtttgagatgccagcc
ggcgagagcgccttcgccaacagcaagtcctcagtgcccactgccggacaccaccaccac
caccacagcaacaaccccggcggcggcggcggctacatgctcagcaagtcgctctacccc
gaccgggtcacgcaaaaccctttcatccccactttcggggacgaccagtgcttgctccac
ggcagcaaatcctacttcttcaggcagccctcggtgccaggggcgccgaaagccaggccg
gacttccgcgcccttgtcaccaacaagccggtggtctcggccctccacggggctgtgcag
ggccgtttccagaaagacatctgtatagggaaccagtccaacccctgtgtgcctaacaac
aaaaaccccagggctttcaatggctccagcaatgggcatgtgtatgagaaactgtccagc
attgagtctgacgtctga

KEGG   Miniopterus natalensis: 107525462
Entry
107525462         CDS       T05883                                 

Gene name
GRIN2A
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2A isoform X1
  KO
K05209  glutamate receptor ionotropic, NMDA 2A
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
mna05034  Alcoholism
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107525462 (GRIN2A)
   04015 Rap1 signaling pathway
    107525462 (GRIN2A)
   04020 Calcium signaling pathway
    107525462 (GRIN2A)
   04024 cAMP signaling pathway
    107525462 (GRIN2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107525462 (GRIN2A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107525462 (GRIN2A)
   04728 Dopaminergic synapse
    107525462 (GRIN2A)
   04720 Long-term potentiation
    107525462 (GRIN2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107525462 (GRIN2A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107525462 (GRIN2A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107525462 (GRIN2A)
   05014 Amyotrophic lateral sclerosis
    107525462 (GRIN2A)
   05017 Spinocerebellar ataxia
    107525462 (GRIN2A)
   05020 Prion disease
    107525462 (GRIN2A)
   05022 Pathways of neurodegeneration - multiple diseases
    107525462 (GRIN2A)
  09165 Substance dependence
   05030 Cocaine addiction
    107525462 (GRIN2A)
   05031 Amphetamine addiction
    107525462 (GRIN2A)
   05033 Nicotine addiction
    107525462 (GRIN2A)
   05034 Alcoholism
    107525462 (GRIN2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107525462 (GRIN2A)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107525462 (GRIN2A)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 107525462
NCBI-ProteinID: XP_016053104
LinkDB
Position
Unknown
AA seq 1463 aa
MGRLGCWTLLVLPALLVWRGPAQGAAAEKGTPALNIAVLLGHSHDVTERELRNLWGPEQA
TGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
FVPILGIHGGASMIMADKDPTSTFFQFGASIQQQAMVMMKIMQDYDWHVFSLVTTIFPGY
RDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILT
TAASSMLERFSYIPEAKTSCYGQTEKPEVPLHTLHQFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTESCVRNTVPCRKFVKINNSTNEGVNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVNQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALL
QFVGDGEMEELEALWLTGICHHEKNEVMSSQLDVDNMAGVFYMLAAAMALSLITFVWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFSLTGSQSNMLKLLRS
AKNMSNISNMNSSRMGSPKRASDLIQRGSLIMDMVSDKGNLIYSDNRSFQGKDSIFGDNM
NELQTFVANRHKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMDS
LRQDSVTQNPVSQRDEGTMENRTHSLKSPRYLPEEVAHSDISETSSRATCHREPDNNKNH
KTKDNFKRSMASKYPKDCSEVERSYLKTKASSPRDKIYTIDGEKEPSFHLDPPQFVENMA
LPENMDFPDAYPDHSENFRKDSTLPMNRNPLHNEDGLPNNDQYKLYSKHFTLKDKSSPLS
EGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNPA
TQEEVYQQDWAQNNTLQFQKNKLRISRQHSYDNILDKPREVDLSRPSRSISLKDRERLLE
GNLYGSLVSVPSSKLLGNKSSLFPQGLEDGKRSKSLLPDHTSDNPFLHSYGDDQRLVIGR
CPSDSYKHSLPSQPANDSYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKTNMYST
PRVLNSCSNRRVYKKMPSIESDV
NT seq 4392 nt   +upstreamnt  +downstreamnt
atggggagactgggctgttggaccctgctggtgctgccggcacttctggtctggcgcggt
ccggcgcagggtgcggcggcggagaagggcaccccggcgctgaacatcgcggtgctgctg
ggtcacagccacgacgtgacggagcgtgaactgcgaaacctgtggggcccggagcaggcg
accgggctgcccctggacgtgaacgtggtagcgctgctgatgaaccgcaccgaccccaag
agcctcatcacacacgtgtgcgacctcatgtccggggcgcgcatccacggcctcgtgttt
ggggacgacaccgaccaggaggccgtggcccagatgctggattttatctcctcacagacc
ttcgtcccgatcctgggcatccacgggggcgcatccatgatcatggccgacaaggatccg
acgtctaccttcttccagtttggagcgtccatccagcaacaggccatggtcatgatgaag
atcatgcaggattacgactggcatgtcttctccctggtgaccaccatcttccctggctac
agggacttcatcagcttcattaagaccacagtggacaacagctttgtgggctgggacatg
cagaacgtgatcaccctggacacttcctttgaggacgcaaagacgcaagtccagctgaag
aagatccactcttctgtcatcttgctctactgctccaaagacgaggctgtcctcatcctg
agcgaggcccgctcccttggcctcactgggtatgatttcttctggattgtccccagcttg
gtctctgggaacacagagctcatccccaaagagtttccatcaggactcatttcagtctcc
tatgatgactgggactacagcctggaggcaagagtgagggatggcctgggcatcctaacc
actgccgcatcttccatgttggagaggttctcctacatcccggaggccaagaccagctgc
tacgggcagacagagaagccagaggtcccgctgcacactctgcaccaatttatggtcaat
gtgacatgggatggcaaagatttgtccttcactgaggaaggctaccaggtgcaccccagg
ctggtggtgattgtgctgaacaaggaccgagagtgggaaaaggtgggcaagtgggagaac
cagaccctgagcctgaggcacgccgtgtggccgagatacaagtccttttcggactgtgag
ccggacgacaaccatctgagcattgtcaccctcgaggaggccccctttgtcatcgtggag
gacatagacccgctgaccgagtcatgtgtgaggaacaccgtaccctgtcggaagttcgtc
aaaatcaataactcaaccaatgagggagtgaatgttaaaaaatgctgcaaggggttctgc
atcgatatcctaaagaagctttccaggactgtgaagtttacctatgacctctacctggtg
accaatgggaagcatggcaaaaaagtcaacaacgtgtggaacggaatgattggcgaggtg
gtcaaccagcgggccgtcatggcagtgggctcgctcaccatcaacgaggagcggtccgaa
gtggtggacttctctgtgcccttcgtggagacggggatcagtgtcatggtctcgagaagc
aatggcaccgtgtcgccttctgcttttctagaaccgttcagcgcctccgtctgggtgatg
atgtttgtcatgctgctcatagtctctgccatagctgtgttcgtctttgaatacttcagt
cctgttggatacaacagaaacttagccaaagggaaagcaccccacgggccttccttcacg
atcggaaaggctatatggctcctctggggcctggtgttcaacaactccgtgcccgtgcag
aaccctaagggcaccaccagcaagatcatggtgtccgtgtgggccttctttgccgtcatc
tttctggccagctacacggccaatctggctgccttcatgatccaggaggagtttgtggac
caagtgactggcctcagtgacaaaaagtttcagaggccgcacgactattccccgcctttt
cgatttggcacggtgcctaacggcagtaccgaaagaaacattcggaataactacccctac
atgcatcagtacatgaccaaatttaatcagaagggagtggaggatgccttggtcagcttg
aaaacagggaagctggatgctttcatctacgatgctgcggtcttgaattacaaggctggg
cgggacgaaggctgcaagctggtgaccatcgggagtgggtacatctttgctaccactggg
tatggaatcgccctccaaaagggctcaccctggaagaggcagatagacctggccctgctc
cagtttgtgggagatggtgagatggaggagctggaggcgctgtggctcaccggcatctgc
caccacgagaagaacgaggtgatgagcagccagctggacgtggacaacatggcgggcgtc
ttctacatgctggcggccgccatggcgctgagcctcatcacctttgtctgggagcacctc
ttctactggaagctgcgcttctgcttcactggcgtctgctccgaccgcccggggctgctc
ttctccatcagcaggggcatttacagctgcattcacggggtgcacatcgaagaaaaaaag
aagtcaccagacttcagtctgactggctcacagagcaacatgttaaaactccttcggtca
gccaaaaacatgtccaacatctccaacatgaactcctcaagaatgggttctcccaaaaga
gcttccgacctcatccaaagaggttccctcatcatggacatggtttcagataagggaaac
ctgatatattcagacaacaggtcctttcaggggaaagacagcatttttggggacaacatg
aatgaactccaaacatttgtggccaacaggcacaaggacaacctcaataactatgtgttc
cagggtcagcaccctctcactctcaatgagtccaaccctaacacagtggaggtggctgtg
agcacggaatccaaagggaactccaggccccggcagctttggaagaaatccatggactct
ctacgccaagattcagtgacccagaacccagtctcccagagggacgaggggaccatggag
aataggacccactccctaaagagtcccaggtaccttccagaagaggtggcccactccgac
atttcagaaacttcgagtcgggccacgtgccacagggaacctgacaacaataagaaccac
aagactaaggacaacttcaaaaggtcgatggcctccaagtaccccaaggactgcagtgag
gttgagcgctcctacttgaaaaccaaagcaagctcccccagagacaagatctacaccatt
gatggtgagaaggagcccagtttccacctagatcccccccagtttgttgaaaacatggcc
cttcccgagaacatggacttcccagatgcctacccggaccacagcgagaacttccgcaag
gactccacgctgcccatgaacaggaaccctctgcacaatgaagacgggctccccaacaat
gaccagtacaagctctactccaagcacttcaccctgaaagacaagagctcccctctcagc
gagggcagcgaccggtaccggcagaactccacgcactgcaggagctgcctctccaacctg
cccacctattcgggccatttcaccatgaggtcgcccttcaagtgcgacgcctgcctgcgg
atggggaacctctacgacatcgacgaagaccagatgctccaggagacagggaacccagcc
acccaggaggaggtctaccagcaggactgggcacagaacaacaccctccagttccaaaag
aacaagctgaggattagccgccagcattcctacgataacatcctcgacaaacccagggag
gtggaccttagcaggccctctcggagcataagcctcaaggacagggaacggctcctggag
ggaaatttgtacgggagtctcgttagtgtcccctccagcaaactcttggggaacaaaagc
tccctcttccctcagggcctggaggacggcaagcggagcaagtccctcttgccagaccac
acctccgacaaccccttcctccactcctacggggacgaccagcgcttagtcattgggagg
tgcccctcggactcctacaaacactcgctgccatcccagccagcgaacgacagctatctc
cgatcctccttgaggtccacggcgtcgtactgttccagggacagtagaggccacagcgat
gtgtatatttccgagcatgttatgccttatgctgcaaataagactaatatgtactctacc
cccagggtgttgaattcctgcagcaatagacgtgtgtacaagaaaatgcctagtattgaa
tctgatgtttaa

KEGG   Miniopterus natalensis: 107531815
Entry
107531815         CDS       T05883                                 

Gene name
GRIN2D
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2D
  KO
K05212  glutamate receptor ionotropic, NMDA 2D
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107531815 (GRIN2D)
   04024 cAMP signaling pathway
    107531815 (GRIN2D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107531815 (GRIN2D)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107531815 (GRIN2D)
   04720 Long-term potentiation
    107531815 (GRIN2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107531815 (GRIN2D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107531815 (GRIN2D)
   05014 Amyotrophic lateral sclerosis
    107531815 (GRIN2D)
   05017 Spinocerebellar ataxia
    107531815 (GRIN2D)
   05020 Prion disease
    107531815 (GRIN2D)
   05022 Pathways of neurodegeneration - multiple diseases
    107531815 (GRIN2D)
  09165 Substance dependence
   05030 Cocaine addiction
    107531815 (GRIN2D)
   05031 Amphetamine addiction
    107531815 (GRIN2D)
   05033 Nicotine addiction
    107531815 (GRIN2D)
   05034 Alcoholism
    107531815 (GRIN2D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531815 (GRIN2D)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107531815 (GRIN2D)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor MatE
Other DBs
NCBI-GeneID: 107531815
NCBI-ProteinID: XP_016061450
LinkDB
Position
Unknown
AA seq 798 aa
MDGQVMGKVKDSTEEINRYISVAHPGCLTPSSSPQEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSLS
AQIRLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGTPGEPLLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
KRCCKGFCIDILKRLAQTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL
TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT
VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL
VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK
NIRSNYPDMHSYMVRYNQPRVEEALTHLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS
GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRKPLTPDCDF
RPLQMVIRPQTVTSDPKL
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggatggtcaggttatgggcaaggttaaggattctacagaagagataaatcgctacatc
tcagtggctcacccaggatgcctgacaccctcctcctccccacaggagaagggctccacc
ttcctgcagctgggctcatccacagagcagcagcttcaggtcatctttgaggtgctggag
gagtatgactggacgtcctttgtagccgtgaccacacgtgcccctggccaccgggccttc
ctatcctacatcgaggtgctgactgatggcagtctggtgggctgggagcaccgcggagct
ctgacactggaccctggggcgggggaggccgtgctgagtgcccagcttcgcagcctcagc
gcacagatccgtctgctcttctgtgcccgcgaggaggccgagcctgtgttccgggcagcc
gaggaagctggcctcactgggcctggctacgtctggttcatggtggggccccagctagct
ggaggcgggggctcaggcacccctggagagccccttcttctgccaggaggcgccccgctg
cctgctgggctgtttgcagtgcgctctgctggctggcgggatgacctggcccggcgtgtg
gcagctggcgtggctgtagtggccagaggtgcccaggccctgctgcgtgactatggcttc
ctgcctgagcttggtcatgattgtcgtgcccagaaccgcacccaccgaggggagagtctg
cataggtacttcatgaatattacctgggacaaccgggattactccttcaatgaggatggc
ttcctggtgaacccctccctggtggtcatctcccttaccagggacaggacttgggaggtg
gtgggcagctgggagcaacagactctccgcctcaagtacccgctatggtcccgctatggt
cgcttcctgcagccagtagatgacacgcagcacctcacggtggccacgctggaggagagg
ccctttgtcatcgtggagcccgctgaccccatcagcggcacttgcatccgagactctgta
ccctgccggagccagctcaaccgcacccacagccctccgccggacgccccccgccccgaa
aagcgctgctgcaagggcttctgcatcgacatcctgaagcggctggcccagaccatcggc
ttcagctacgacctctacctggtcaccaacggcaagcacggcaaaaagatcgacggcgtc
tggaacggcatgatcggggaggtgttctaccagcgcgcggacatggccatcggctccctc
accataaacgaggagcggtcggagatcgtggacttctccgtccccttcgtggagacaggc
atcagcgtgatggtggcacgcagcaacggcaccgtgtccccctccgccttcctcgagccc
tacagccccgccgtgtgggtgatgatgttcgtcatgtgcctcactgtggtcgccgtcact
gttttcatcttcgagtacctcagtcctgtgggttacaaccgcagcctggccaccggcaag
cgccctggtggctcaaccttcaccattggaaagtccatctggctgctctgggccctggtg
ttcaataactcggtgcccgtggagaacccccggggtaccaccagcaaaatcatggtgctg
gtgtgggccttcttcgctgtcatcttcctcgccagctacacagctaacctggccgccttc
atgatccaggaggagtacgtggacaccgtgtctgggctcagtgaccgaaagttccagcgg
ccccaggagcagtacccgcccctgaagttcgggacggtgcccaacgggtccacggagaag
aacatccgcagcaactaccccgacatgcacagctacatggtgcgctacaaccagccgcgc
gtggaggaggcgctcactcatctcaaggcagggaagctggacgccttcatctatgacgcc
gctgtgctcaactacatggcccgcaaggacgagggctgcaagctcgtcaccattggctcg
ggcaaggtctttgccaccacgggctatggcatcgcgctgcacaagggctcccgctggaag
cggcccatcgacctggcgctcctgcagttcctcggagacgatgagatcgagatgctggag
cggctgtggctttccgggatctgccacaacgacaaaatcgaggtgatgagtagcaagctg
gacatcgacaacatggcgggtgtcttctacatgctcctggtggccatgggcctctccctg
ctggtcttcgcgtgggagcacctggtgtactggcgcctgcggcactgcctggggcccacc
caccgcatggacttcctgctggccttctccaggaaacccctgaccccagactgtgacttc
cgacccctacaaatggtcatccgaccccagactgtgacctctgaccccaaactgtga

KEGG   Miniopterus natalensis: 107534564
Entry
107534564         CDS       T05883                                 

Gene name
GRIN3B
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor ionotropic, NMDA 3B
  KO
K05214  glutamate receptor ionotropic, NMDA 3B
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04724  Glutamatergic synapse
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107534564 (GRIN3B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107534564 (GRIN3B)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107534564 (GRIN3B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107534564 (GRIN3B)
   05020 Prion disease
    107534564 (GRIN3B)
  09165 Substance dependence
   05030 Cocaine addiction
    107534564 (GRIN3B)
   05031 Amphetamine addiction
    107534564 (GRIN3B)
   05033 Nicotine addiction
    107534564 (GRIN3B)
   05034 Alcoholism
    107534564 (GRIN3B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107534564 (GRIN3B)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107534564 (GRIN3B)
SSDB
Motif
Pfam: Lig_chan-Glu_bd Lig_chan SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 107534564
NCBI-ProteinID: XP_016065183
LinkDB
Position
Unknown
AA seq 1039 aa
MGFVRVLWLGLALALGPMPARGHPQPCGVLARLGTLLPRATAARVRTCIALARAVLAPRP
PHNLSLELVATATSARDPASLARGLCQTLAALLAFPEARPELLRLRFLGAXTETPVLSLR
RLEARAPRRPNPFHLQLDWASPLETLLEVLVSVLQAHAWEEDGLVQDPGGLMALWTSQAG
RAPKFVLDISQPDTSDAGLQAHLSLLVALEGGSALVPVAVLLGCDMARARQVLETVPSGP
XWLLGTPLPAEALPTEGLPPGLLALGEVARPPLEAAIHDAVELIAQALGSAAHVQPEHAL
LPATINCNDQKPVKPKSSGSFLARFLSNTSFQGRTGPVWVTSSSQVYMSRHFRVWSLLQD
PLGTPAWARLGSWQDGWLELEPGGAAVQPPPPLGTQAQPKLPVVTLVEHPFVFAREPDKD
GQCPAGQLCLAPGTNVSATLDMLFPALANGSVPHALRKCCYGYCIDLLECLAEDIPFDFE
LYIVGDDQYGTLQDGRWTGLVGDLLAGRAHMVVTSFSINSACSKVVDFSSPFFSTSLGIM
VQARDTASPLGTFMWPLHWSTWLGVFATLHFTMLFLTLYEWRSPYGLTPRGRNRGTVFSY
SSTLNLCYAILFGRTVSSKTPKCPTGRLFMNLWAIFCLLVLSSYTANLAAVMVGDKTFEE
LSGIHDPKLHHPSQGFRFGTVWESSADACIKKSFLEMYVHMRRHSAPTTPHGVVMLTSDP
PKLNAFIMDKSLLDXEVSIDADCKLLIVGKPFAIEGYGIGLPQNSPLTSNLXFISHYKSS
GFIDLLHDKWYKMVPCGKRVFAVTELGQGLGYRVGVSVLLCVGVGSALLSSLGKHIFYLL
VLPCIQKGXRLQYWLHTSQRIHSALNTEPPERGHLFPAHPSSVPRGLEKQQQDIPTAPSG
QGDWTQVHQAMVRECHACCLLESTLATAASXWTDMEGARSLEGPIGLCSNGRLPTALPTG
APRPGELEELEQHIAGACTRLHQALVRRGELMAQLPGGTVTVPAPGLQGSSRGPPSEVST
CFVCGRWPCPTTPSPLGFA
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgggttttgtgcgagtgctgtggctgggcctcgcgctggcgctgggacccatgcctgcc
aggggccacccgcaaccctgcggcgtcctggcgcgcctgggcaccctcctgccccgcgca
actgctgcccgcgtccgcacctgcatcgccctggcccgggcagtactggcgccacggcca
ccgcacaacttgagcttggagctggtggccaccgcgacctctgcccgcgaccccgcctct
ctggcccgtggcctctgccagacgctggcggcgctgctcgccttccccgaggcgcggccg
gagctgctgcggctgcgtttcctgggggccngcacggagaccccagtgctcagcctgcgg
cggctggaggcgcgcgcccctcggcgcccgaacccgttccacctacagctggactgggcc
agtcccctggagacgctgcttgaggtgctggtgtccgtgctacaggcccatgcctgggaa
gaagatggcctggtgcaggaccctggtggcctcatggccctctggacaagccaggctggc
agggccccaaagtttgtgctagacataagccagccagacaccagtgatgcagggctgcag
gcccacctttccttgctggtggccctggaggggggctcagccctggtaccggtggctgtg
ctccttggctgtgacatggcccgtgcccgtcaggtgctggagactgtgccctctgggccc
ncctggctgctaggcacaccactgcctgctgaggcactgcccactgaaggtctgccacct
gggctgctggcgctgggagaggtggctcgacccccactggaggctgctatccacgatgct
gtggagctgatagcacaggcactgggcagtgcagcccatgtgcagccagagcatgccctt
ctccctgccaccatcaactgcaatgaccagaagccagtcaagcccaagtcctcaggcagc
ttcttggctaggttcctgagcaacacatccttccagggccgcacagggccagtatgggtg
accagctcctcccaggtgtacatgtccaggcacttccgggtgtggagccttctccaggac
ccgctgggcactccagcttgggccagactgggcagctggcaggatgggtggctggagttg
gagccagggggtgctgctgtgcagcccccacccccgctgggcacccaggcccagcccaag
ctgcccgtggtgaccctggtggagcacccatttgtgtttgccagagagccagacaaggat
gggcagtgcccggcaggacagctgtgcctggcccctggcaccaatgtctcagccaccctg
gatatgctgtttcctgccttggccaatggctcagtgccccacgccctgcgcaagtgttgc
tatggttactgcatcgacctgctggagtgcctggcagaggacataccctttgactttgag
ctgtacattgtgggcgatgaccagtatggcactctgcaggatggccgctggactggcttg
gtgggagacctgctggctggcagggcccacatggtagtcaccagcttcagcatcaactca
gcctgctcaaaggtggtggacttcagcagccccttcttctccaccagcctgggcatcatg
gtgcaggcgagagacacagcctcaccccttggcacctttatgtggccgctgcactggtcc
acgtggttgggtgtttttgccaccctgcacttcaccatgctcttcctcacactctatgag
tggcgcagtccctatggcctcacgccccgtggccggaaccgcggcaccgttttctcctat
tcttcgaccctcaacctctgctatgccatcctgttcggacgcacagtgtccagcaaaaca
cccaagtgccccacggggcgtctgttcatgaacctgtgggccatcttctgcctgctcgtg
ctgtctagctacacggccaacctggctgctgtcatggttggggacaagactttcgaggag
ctgtcagggattcacgaccccaagctgcaccacccgtcccagggcttccgctttggcact
gtgtgggagagcagcgcagacgcctgcatcaagaagagcttcctcgagatgtacgtgcac
atgaggcgacacagtgcacccaccacaccccatggtgtcgtgatgcttacgagcgacccc
cccaagctcaatgccttcatcatggacaagtcgcttctggacnntgaggtctccatcgat
gccgactgcaaactgctgattgtgggcaagccctttgccattgagggttatggcattgga
ctccctcagaattcgccgctcacctccaacctanagttcatcagccactacaagtcctct
ggcttcattgacctgctgcatgacaagtggtacaagatggtaccttgtgggaagcgggta
ttcgctgtcacagagctgggacagggcctgggatatagggtgggggtctctgtgctgctc
tgtgtgggcgtgggtagtgccttactcagttctctggggaagcacattttctacctccta
gtgctgccatgtatccagaagggcnacaggctgcagtactggctacacacgagccaaaga
atccacagtgccctcaacacggagccaccagagaggggccacctgttcccagcccatcca
tcctctgtccccaggggtctggagaagcagcagcaagacataccaactgccccctcaggc
cagggtgactggacacaggtgcatcaggccatggtaagggagtgtcacgcgtgctgtctc
ctggagtcaaccttggccactgctgcatcatagtggacagatatggaaggggccagatca
ctcgagggtcccattgggctctgctccaatggccggctacccacagcactacccacaggc
gccccacgcccaggtgagctggaggaactggaacagcacatcgcaggtgcgtgtacaagg
ctccaccaggcactggtgcggcgtggggagctcatggcccagctcccaggtggaactgtt
actgtgcctgctccaggcctacaggggagcagcagggggcctcctagtgaggtctccacc
tgctttgtctgtgggaggtggccatgccccaccacacccagcccacttggttttgcatga

KEGG   Miniopterus natalensis: 107536149
Entry
107536149         CDS       T05883                                 

Gene name
GRIN1
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor ionotropic, NMDA 1
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107536149 (GRIN1)
   04015 Rap1 signaling pathway
    107536149 (GRIN1)
   04020 Calcium signaling pathway
    107536149 (GRIN1)
   04024 cAMP signaling pathway
    107536149 (GRIN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107536149 (GRIN1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107536149 (GRIN1)
   04720 Long-term potentiation
    107536149 (GRIN1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107536149 (GRIN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536149 (GRIN1)
   05014 Amyotrophic lateral sclerosis
    107536149 (GRIN1)
   05016 Huntington disease
    107536149 (GRIN1)
   05017 Spinocerebellar ataxia
    107536149 (GRIN1)
   05020 Prion disease
    107536149 (GRIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    107536149 (GRIN1)
  09165 Substance dependence
   05030 Cocaine addiction
    107536149 (GRIN1)
   05031 Amphetamine addiction
    107536149 (GRIN1)
   05033 Nicotine addiction
    107536149 (GRIN1)
   05034 Alcoholism
    107536149 (GRIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107536149 (GRIN1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107536149 (GRIN1)
SSDB
Motif
Pfam: ANF_receptor Lig_chan-Glu_bd CaM_bdg_C0 SBP_bac_3 Peripla_BP_6 Lig_chan
Other DBs
NCBI-GeneID: 107536149
NCBI-ProteinID: XP_016067262
LinkDB
Position
Unknown
AA seq 786 aa
MSTMRLLTLALLFSCSFARAACDPKIVNIGAVLSTRKHEQVFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVPPRPIPRFTPTPVSYTAGFYRIPVLGLTTRMSI
YSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYGWNHVILLVSDDHEGRAAQKRLETLLEER
ESKAEKVLQFDPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNMTGSGYVW
LVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVSVVAQAVHELLEKENITDPPRG
CVGNTNIWKTGPLFKRVLMSSKYAEGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIY
NGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVN
GDPVKKVICTGPXGRGLSGAPGTLEAHXGGARSSGADGARAPPPCRPQVNNSNKKEWNGM
MGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKKKSQCVQAGWEPRDGAG
RESFRLAGGSANARVEGRPTARAPVTPVPACSKLHAFIWDSAVLEFEASQKCDLVTTGEL
FFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFEN
MAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEP
DPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQMC
ARHRES
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgagcaccatgcgcctgctgacactcgccctgcttttctcctgctccttcgcccgcgcc
gcctgcgaccccaagatcgtcaacatcggcgccgtgctgagcacccgaaagcacgagcag
gttttccgcgaggccgtgaaccaggccaacaagcggcacggctcctggaagatccagctc
aacgccacctccgtcacgcacaagcccaacgccatccagatggccctgtcggtgtgcgag
gacctcatctccagccaggtgcccccgcgccccatcccccgcttcacccccacccccgtc
tcctacacggccggcttctaccgcatccctgtcctggggctgaccacccgcatgtccatc
tactcagacaagagcatccacctgagcttcctgcgcacggtgccgccctactcccaccag
tcgagcgtctggttcgagatgatgcgcgtctacggctggaaccacgtcatcctgctggtc
agcgacgaccacgagggccgcgcggcgcagaagcgcctggagacgctgctggaggagcgc
gagtccaaggcggagaaggtgctgcagtttgacccggggaccaagaacgtgacggccctg
ctgatggaggcacgggagctggaggcacgggtcatcatcctctctgccagcgaggacgac
gctgccaccgtgtaccgcgcagccgcgatgctgaacatgacgggctcggggtacgtgtgg
ctggtgggggagcgcgagatctcggggaacgccctgcgctacgccccggacggcatcatc
gggctgcagctcatcaacggcaagaacgagtccgcgcacatcagcgacgccgtgagcgtg
gtggcgcaggcggtgcacgagctgctggagaaggagaacatcacggacccgccgcgcggc
tgcgtgggcaacaccaacatctggaaaaccgggccgctcttcaagagagtgctgatgtct
tccaaatacgcggaaggggtgaccggacgcgtggagttcaatgaggacggcgaccgtaag
ttcgccaactacagtatcatgaacctgcagaaccgcaagctggtgcaagtgggcatctac
aatggcacccatgtcatccccaatgaccggaagatcatctggccaggaggagagacagag
aaaccccgagggtaccagatgtccaccaggctaaagatcgtgaccatccaccaggagccc
ttcgtgtacgtcaagcccacgatgagcgacggcacgtgcaaggaggagttcacagtcaac
ggggaccccgtcaagaaagtgatctgcaccgggcccngggggcggggtctgagcggggcg
ccggggaccctggaagcgcactagggtggagcccgttcgagtggagccgacggtgcccgc
gccccaccgccgtgccgcccccaggtgaacaacagcaataagaaggagtggaacgggatg
atgggcgagctgctcagcgggcaggcggacatgatcgtggccccgctgaccatcaacaac
gagcgagcccagtacatcgagttctccaagcccttcaagtaccagggcctgaccattctg
gtcaagaagaagaaaagccagtgtgtccaggctgggtgggaaccccgggacggagctgga
cgtgagagtttcaggctggcaggagggagtgcaaacgcgcgggtcgagggtcgcccgacg
gcgcgggctccggtgacccccgtccctgcctgcagcaaactgcacgccttcatctgggac
tcggcggtgctggagttcgaggcctcgcagaagtgcgacctggtgaccacgggcgagctg
ttcttccgctctggcttcggcatcggaatgcgcaaggacagcccctggaagcagaacgtc
tccctgtccatcctcaagtcccatgagaacggcttcatggaagacctggacaagacgtgg
gtgcggtaccaggagtgtgactcgcgcagcaatgcccctgctactctcaccttcgagaac
atggcaggggtcttcatgctggtggctggaggcatcgtggctggaatcttcctgatcttc
atcgaaatcgcctacaagcggcacaaggatgctcgccggaagcagatgcagctagccttt
gccgcggtgaatgtgtggagaaagaacctgcaggatagaaagagtggtagagcagagccc
gaccctaaaaagaaagccacatttagggctatcacctccaccctggcttccagcttcaag
agacgtaggtcctccaaagacacgagcaccgggggtggacgcggcgctttgcaaaaccaa
aaagacacagtgctgccgcgacgtgctattgagagggaggagggccagctgcagatgtgt
gcccgtcatagggagagctga

KEGG   Miniopterus natalensis: 107542924
Entry
107542924         CDS       T05883                                 

Gene name
GRIN2C
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2C
  KO
K05211  glutamate receptor ionotropic, NMDA 2C
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107542924 (GRIN2C)
   04024 cAMP signaling pathway
    107542924 (GRIN2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107542924 (GRIN2C)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107542924 (GRIN2C)
   04720 Long-term potentiation
    107542924 (GRIN2C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107542924 (GRIN2C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107542924 (GRIN2C)
   05014 Amyotrophic lateral sclerosis
    107542924 (GRIN2C)
   05017 Spinocerebellar ataxia
    107542924 (GRIN2C)
   05020 Prion disease
    107542924 (GRIN2C)
   05022 Pathways of neurodegeneration - multiple diseases
    107542924 (GRIN2C)
  09165 Substance dependence
   05030 Cocaine addiction
    107542924 (GRIN2C)
   05031 Amphetamine addiction
    107542924 (GRIN2C)
   05033 Nicotine addiction
    107542924 (GRIN2C)
   05034 Alcoholism
    107542924 (GRIN2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107542924 (GRIN2C)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107542924 (GRIN2C)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 NMDAR2_C
Other DBs
NCBI-GeneID: 107542924
NCBI-ProteinID: XP_016075835
LinkDB
Position
Unknown
AA seq 899 aa
MGGALGPALLLTSLLGAWAGLGLGQGEQAVTVAVVFGSSGPPQAQARTRLTPQSFLDLPL
EIQPLTVGVNNTNPSSLLTQICGLLGAARVHGIVFEDNVGTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKVLIQVFPVGLISVVTESWRLSLRQKVRDGVAILALGAHGYRRQHGAL
PAPAGDCRSHPGPVSPARGAFYRHLLNITWEGRDFSFSPGGYLVQPTMVVISLNRHRLWE
MVGRWDHGVLHMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPDPGTGGCVPNT
VPCRRQSNHTFSSGDTAPYTKLCCKGFCIDILKKLAKAVRFSYDLYLVTNGKHGKRVRGV
WNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEP
YSPSVWVMMFVMCLTVVAVTVFMFEYFSPVSYNQNLTSGKKSGGPSFTIGKSVWLLWALV
FNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQR
PQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKMGKLDAFIYDA
AVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKESHWKRAIDLALLQFLGDGETQKLE
TVWLSGICHNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVYWKLRHSVPNT
SRLDFLLAFSRGIYSCFSGVQSLASPARPPSPALSASSAQASVLKMLQAARDMVTTAGVS
SSLDRATRTIENWGSRRACPEGAWAGHPAWPHRQHACLYAHARLPLCWGAVCPHLPPCAS
HGPWLAGAWEPPGRRGRTLGLSTGYRDSGGPGAGRAACGAQGFLGPCAWRRIDSLESEV
NT seq 2700 nt   +upstreamnt  +downstreamnt
atgggtggggctctggggccagccctgctgctcacctcactccttggtgcctgggcaggg
ctgggcctcgggcagggcgaacaggctgtgacggtggccgtggtgtttggcagctcgggg
ccaccacaggcccaggcccggacccgcctcaccccccagagcttcctggacctgcccttg
gagatccagccactcaccgtgggggtcaacaacaccaaccccagcagcctcctcacccag
atctgtgggctcctgggtgcggcccgggtccacggcatcgtctttgaggacaacgtgggc
acagaggccgtggcccagatcctcgacttcatctcctcccagactcacgtgcccatcctc
agcatcagtgggggctctgctgtggtcctcacccccaaggttctcatccaagtcttcccg
gtcggcctcatcagcgtggtcaccgagagctggcggctcagcctgcgccagaaggttcgc
gacggcgtggccatcctggccctgggcgcgcatggctaccggcgccagcacggcgcgctg
cctgccccggctggggactgtcgcagccaccccgggcctgttagccctgccaggggggcc
ttctacaggcacctactgaacatcacctgggagggccgagacttctccttcagccctggt
gggtacctggtccagcccaccatggttgtcatctccctcaaccggcaccgcctctgggag
atggtggggcgctgggaccatggcgtcctccacatgaagtacccagtgtggcctcgctac
agtgcctccctgcagcccgtggtggacagccggcacctgacggtggccacactggaggag
cggccctttgtcattgtggagagccccgaccctggcaccggcggctgtgtgcccaacact
gtgccctgccgcaggcagagcaaccacaccttcagcagtggcgacacagccccctacacc
aagctctgctgtaagggcttctgcatcgacatcctcaagaagctggccaaggcggtcagg
ttctcctacgacctgtacctggtgaccaacggcaagcatggcaagagggtgcgcggcgtg
tggaacggcatgatcggggaggtatactacaagcgggcggacatggccatcggctccctc
accatcaacgaggagcgctccgagatcgtggacttctctgtgcccttcgtggagacgggc
atcagcgtgatggtggcgcgcagcaacggcaccgtgtctccttcagccttcctggaaccc
tacagcccctcggtgtgggtgatgatgttcgtcatgtgcctcaccgtggtggctgtcact
gtcttcatgttcgagtacttcagcccagtcagctacaaccagaacctcaccagcggcaag
aagtctggtggcccatccttcaccatcggcaagtctgtgtggctgctgtgggcactggtc
ttcaacaactcggtgcccatcgagaacccccggggcaccaccagcaagattatggtcctg
gtctgggccttctttgctgtcattttccttgccagctacactgccaacttggctgccttc
atgatccaggagcagtacatcgacactgtgtcgggcctcagtgacaagaagtttcagcgg
cctcaagaccagtacccaccctttcgcttcggcacggtgcccaacggcagcacagagcgg
aacattcgcagcaactaccgagacatgcacacccacatggtcaagttcaaccagcgctct
gtggaggacgcgctcaccagcctcaagatggggaagctggatgccttcatctacgatgcc
gctgtcctcaactacatggcaggcaaggatgaaggctgcaagctggtcaccattggctct
ggcaaggtctttgccaccaccggctatggcatcgccatgcagaaggagtcccactggaag
cgagccatagacctggcgctcctgcagttcctgggggacggggagacacagaagctggag
accgtgtggctctcggggatctgccacaacgagaagaacgaggtgatgagcagcaagctg
gacatcgacaacatggccggcgtcttctacatgctgctcgtggccatggggctggccctg
ctggtctttgcctgggagcacctggtctactggaagctgcgccactcggtgcccaacacg
tcccgcctggacttcctgctggccttcagcaggggcatctacagctgcttcagcggggtg
cagagcctggccagccccgcgcgcccgcccagcccggccctgtcggccagctcggcccag
gccagtgtgctcaagatgctgcaggcggcgcgcgacatggtgaccacggctggcgtgagt
agctccctggaccgcgccacgcgcaccattgagaactggggcagccgccgggcctgtccc
gagggcgcgtgggccgggcaccccgcctggccgcaccgacagcacgcctgcctctacgcc
catgcccgcctgccgctctgctggggggctgtgtgcccccacctgcccccctgtgccagc
catggcccctggctggctggggcctgggagcctccagggcgcaggggcaggaccctgggg
ctgagcacaggctacagggacagcggggggccgggggccggcagggcggcctgtggggcg
cagggcttcctgggaccctgcgcctggaggcggatagacagcttggagtcagaagtgtga

KEGG   Miniopterus natalensis: 107546596
Entry
107546596         CDS       T05883                                 

Gene name
GRIN3A
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 3A
  KO
K05213  glutamate receptor ionotropic, NMDA 3A
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04724  Glutamatergic synapse
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107546596 (GRIN3A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107546596 (GRIN3A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107546596 (GRIN3A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107546596 (GRIN3A)
   05020 Prion disease
    107546596 (GRIN3A)
  09165 Substance dependence
   05030 Cocaine addiction
    107546596 (GRIN3A)
   05031 Amphetamine addiction
    107546596 (GRIN3A)
   05033 Nicotine addiction
    107546596 (GRIN3A)
   05034 Alcoholism
    107546596 (GRIN3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107546596 (GRIN3A)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107546596 (GRIN3A)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 107546596
NCBI-ProteinID: XP_016080513
LinkDB
Position
Unknown
AA seq 993 aa
AETLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPF
SFLQSVCHTVVVQGVSALLAFPQSAGEMMELDLVGSVLRIPVISIVRREFPRESQSPLHL
QLSLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLRLTQHNARFRLGSVVNIT
ANLSSPEALVGFLQAQLESVRNSTPTMVMFGCDMESVRRIFEITTQFGVMPPELRWVLGD
SQNVEELRTEGLPLGLIAHGKTAPSVFEYYVQDAMELVARAVATATMIQPELALIPSTVN
CMDVETANLTSGQYLSRFLANTTFRGLSGSIKVKGSSIISSENNFFIWNLQHDPMGKPMW
TRLGSWQGGKVVMDYGIWPEQAQRHKTHLQHPSKLHLRVVTLIEHPFVFTREVDDEGLCP
AGQLCLDPVTNDSSILDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKLAEDMNFDFDLY
IVGDGKYGAWKNGHWTGLVGDLLSGSAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVR
TRDTAAPIGAFMWPLHWTLWLGIFVALHVTAIFLTLYEWKSPFGMTPKGRNRNKVFSFSS
ALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELS
GIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPNGVENLKNDPEK
LDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHG
FMDALHDKWYKVVPCGKRSFAVTETLQMGIEHFSGLFVLLVAGFGLSILTALGEHVVYRL
VLPRIKSKSRLHYWLHTSQRLHRALNTSLVEEKPPRFKTKRVEKRFSAGPRQLSVWNTCN
QSHDNRRKYIFSEEEGQNQPGVRTHQDIPLPPRREPPAPLATNGRADGLRGAALQELSEL
EKQIQVIRQELRLAVSRKAELEEYQRTHRTRES
NT seq 2982 nt   +upstreamnt  +downstreamnt
gccgagaccctgtggcctcgggacgccctcctgttcgccgtggacaacctgaaccgcgtg
gaagggctgctgccctacaacctgtctttggaagtggtgatggccatcgaggcgggcctg
ggcgacctgccgctcttgcctttctcctcccccagctcgccgtggagcagcgaccccttc
tccttcctgcagagcgtgtgccacaccgtggtggtgcagggggtgtcggcgctgctggcc
ttcccccagagcgcgggcgagatgatggagctcgacctggtcggctccgtcctgcgcatc
ccggtcatcagcatcgtgcgccgcgagtttccgcgggagagtcagagtccccttcaccta
cagctgagtttagaaaattcattaagttctgacgctgatgtcactgtctcaatcctgacc
atgaacaactggtacaattttagcttgttgctgtgccaggaagactggaacatcaccgac
ttcctccgcctcacccagcacaatgccaggttccgcctgggctctgtcgtcaacatcacc
gccaacctctcctcccccgaggccctcgtgggcttcctgcaggcccagctcgagagcgtg
aggaacagcacgcccaccatggtgatgttcggctgcgacatggagagcgtccggcggatt
ttcgagattaccacccagtttggggtgatgccccccgagcttcgttgggtgctgggggac
tcacagaacgtcgaggaactgaggacggaaggtcttcccttagggctcattgctcacgga
aaaacggcaccgtcggtctttgaatactatgtgcaagatgccatggaattggtcgcaaga
gctgtcgccacggccaccatgatccagccagaactggctctcatccccagcacagtgaac
tgcatggatgtggaaactgcgaatctcacttcgggacaatatctgtcaaggtttctagcc
aacaccacttttagaggcctcagtggttccatcaaagtaaaaggttcctctatcatcagc
tcagaaaacaactttttcatctggaatctgcagcatgaccccatgggaaagccaatgtgg
acccgcttgggcagctggcaggggggaaaggttgtcatggactatggaatatggccagag
caggcccagaggcacaaaacccacctccaacacccaagtaagctccacttgagagtggtt
accctgattgagcatccgtttgtcttcacacgggaggtagatgatgaaggtctgtgccct
gctggccaactctgccttgaccccgtgactaatgactcttccatattggacagccttttt
agtagcctccatagcagtaatgatacagtgcccatcaaattcaagaagtgctgctatgga
tattgcattgatctgctggaaaagctagcagaagacatgaactttgactttgacctctat
attgttggagatggaaaatatggagcctggaaaaatgggcactggaccggactggtgggt
gatctcctgagcgggtcagcccacatggcagtcacttccttcagcatcaatactgctcga
agccaggtgatagatttcaccagtcctttcttctccaccagcttgggcatcttagtgagg
acccgagacacagcagctcccattggagccttcatgtggccactccactggacgttgtgg
ctagggattttcgtggctctgcacgtcactgccatcttcctcactctgtacgaatggaag
agcccctttggtatgacccccaaggggcggaataggaataaagtcttctccttctcttca
gccttgaacgtctgttatgccctcttgtttggcagaacagcagccatcaaacccccaaaa
tgctggactggaaggtttctaatgaacctgtgggccattttctgtatgttttgcctttct
acatacacggcaaacttggctgctgtcatggtaggagagaagatctatgaagagctttct
gggatacacgaccctaagctccatcatccttcccaaggcttccgctttggaactgtccgg
gagagcagtgctgaagactatgtgaggcagagcttccccgagatgcatgagtacatgaga
aggtacaatgtaccggccacccccaatggagtggagaatctgaagaacgatccagagaaa
ctggacgccttcatcatggacaaagcccttctggattatgaagtgtccatagatgctgac
tgcaaacttcttaccgtggggaagccatttgccatagaaggatacggcattgggctccca
cccaactctccactgacctccaatatctctgagctaatcagtcagtacaagtcacatggg
tttatggatgcgctgcacgacaagtggtacaaagtggttccctgcggcaagagaagcttt
gccgtcactgagactttgcagatgggcatcgagcatttctccgggctcttcgtgctgctg
gtcgccggattcggcctgtccatcctgacggccctcggcgagcacgtagtgtacaggctg
gtgctgccacggatcaagagcaagtctcggctgcactactggctccacaccagtcagaga
ttacacagagcactaaacacatcgcttgtagaggaaaagccgccgcgtttcaagactaaa
cgtgtggaaaagaggttcagtgcggggccccggcagctctccgtgtggaatacctgcaac
cagagtcacgacaaccgaagaaaatacatctttagtgaggaggaaggacagaaccagccg
ggcgtccggacccaccaggacatccctctcccgccgaggagggagccccccgccccgctg
gccaccaacgggagggcagacggcctgcgcggggcggcgctgcaggagctctcggagctg
gagaagcagatccaggtgatccggcaggagctgcgcctggccgtgagccggaaggcggag
ctggaggagtaccagaggacacaccggactcgcgagtcctag

DBGET integrated database retrieval system