KEGG   Miniopterus natalensis: 107525352
Entry
107525352         CDS       T05883                                 

Gene name
ARHGDIB
Definition
(RefSeq) rho GDP-dissociation inhibitor 2
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
mna  Miniopterus natalensis
Pathway
mna04722  Neurotrophin signaling pathway
mna04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107525352 (ARHGDIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107525352 (ARHGDIB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107525352 (ARHGDIB)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107525352 (ARHGDIB)
  Exosomal proteins of other body fluids (saliva and urine)
   107525352 (ARHGDIB)
  Exosomal proteins of colorectal cancer cells
   107525352 (ARHGDIB)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 107525352
NCBI-ProteinID: XP_016052984
LinkDB
Position
Unknown
AA seq 200 aa
MTEKAPEPHLEEEEEELDGKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDGPVVAD
PKAPNVTVTRLTLVCESAPGPITMDLTGDLEALKKEIFVLKEGVEYRVKICFKVNRDIVS
GLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPIEEAPKGMLARGTYHNKSFFTDD
DKHDHLTWEWNLSIKKEWTE
NT seq 603 nt   +upstreamnt  +downstreamnt
atgactgaaaaggccccagaaccacacctggaagaggaggaggaggagctggatgggaag
ctcaattacaagcctccccctcagaagtccctgaaggagctgcaagagatggacaaagat
gatgaaagtctaactaagtacaagaaaacgctcctgggggatggccctgtggtagcagac
cccaaagcccccaatgtcactgtcacccgcctcaccctggtctgtgagagtgccccagga
ccgatcaccatggacctcaccggggatcttgaagccctcaaaaaagaaatttttgtgcta
aaggaaggtgttgaatacagagtgaaaatttgcttcaaagtgaacagagatattgtgtcc
ggcctgaaatatgttcagcacacctaccggactggggtgaaagtggacaaagccacattt
atggttggcagttacgggcctcggccagaagagtatgagttcctgactccgatcgaggag
gctcccaaaggcatgctggccagaggcacctaccacaacaagtctttcttcaccgatgac
gacaagcacgaccacctcacctgggagtggaacctgtccattaagaaggagtggacagaa
tga

KEGG   Miniopterus natalensis: 107539056
Entry
107539056         CDS       T05883                                 

Gene name
ARHGDIA
Definition
(RefSeq) rho GDP-dissociation inhibitor 1
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
mna  Miniopterus natalensis
Pathway
mna04722  Neurotrophin signaling pathway
mna04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107539056 (ARHGDIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107539056 (ARHGDIA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539056 (ARHGDIA)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539056 (ARHGDIA)
  Exosomal proteins of other body fluids (saliva and urine)
   107539056 (ARHGDIA)
  Exosomal proteins of colorectal cancer cells
   107539056 (ARHGDIA)
SSDB
Motif
Pfam: Rho_GDI DUF4249
Other DBs
NCBI-GeneID: 107539056
NCBI-ProteinID: XP_016070916
LinkDB
Position
Unknown
AA seq 204 aa
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSR
FTDDDKTDHLSWEWNLTIKKEWKD
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcggagcaggagcccacggccgagcagctggcgcagatcgcggcagagaacgaggag
gacgagcactcggtcaactacaagccacccgcccagaagagcatccaggagatccaggag
ctggacaaggacgacgagagcctccgcaagtacaaggaggccctgctgggccgcgtggcc
gtgtctgcggaccccaacgtccccaacgtcgtggtcacccgcctgaccctggtgtgcagc
accgcgcccggccccctggagctggacctgacaggtgacctggagagcttcaagaagcag
tcctttgtgctgaaggagggtgtggagtatcggataaagatctctttccgggtgaaccga
gagatcgtgtctggcatgaagtacatccaacacacgtaccggaaaggcgtcaagattgac
aagactgactacatggtgggcagctacgggccccgggcagaggagtacgagttcctgacc
cccatggaggaggcgcccaagggcatgctggctcgaggcagctacaacatcaagtcccgc
ttcacagatgacgacaaaactgaccacctgtcctgggagtggaacctcaccatcaaaaag
gagtggaaggactga

KEGG   Miniopterus natalensis: 107539648
Entry
107539648         CDS       T05883                                 

Gene name
ARHGDIG
Definition
(RefSeq) rho GDP-dissociation inhibitor 3
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
mna  Miniopterus natalensis
Pathway
mna04722  Neurotrophin signaling pathway
mna04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107539648 (ARHGDIG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107539648 (ARHGDIG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539648 (ARHGDIG)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539648 (ARHGDIG)
  Exosomal proteins of other body fluids (saliva and urine)
   107539648 (ARHGDIG)
  Exosomal proteins of colorectal cancer cells
   107539648 (ARHGDIG)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 107539648
NCBI-ProteinID: XP_016071700
LinkDB
Position
Unknown
AA seq 218 aa
MNAREAGSSCSLTSLTPVLLTDKEGGQLPPDEVLDEAVPGYQAPGRKSLLEIQQLDPDDE
SLAKYKRVLLGSLPPAVDPSLPNVQVTRLTLMSEQAPGPMTMDLTGELAALKNQVFVLKE
GVDYKVKITFKVNKEIVSGLKCLHHTYRRGLRVDKAVYMVGSYGPRAQEYEFVTPVEEAP
RGALVRGAYMVTSFFTDDDRADHLSWEWGLHICQDWKS
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaatgccagggaagctggcagcagttgttcactcacctccctgaccccagtccttctg
acagacaaggaaggggggcagctgccaccagacgaggtgctggatgaggctgtgccaggg
taccaggccccggggaggaagagccttctagagatccaacagctggacccggatgatgag
agcctggccaagtacaagcgggtgcttctgggttccctgccaccagcagtggacccaagc
ctgcctaacgtgcaggtgaccaggctgactctgatgtctgagcaggctccagggcccatg
accatggacctcacaggggagctggctgcgctgaaaaatcaggtgttcgtcctgaaggag
ggtgttgattacaaagtgaagattacctttaaggtcaataaggaaattgtcagtggcctc
aagtgtctgcatcacacctaccgcaggggcctgcgagtggacaaggctgtgtacatggtg
ggcagttatggcccaagagcccaggagtacgagtttgtaactccagtggaggaggcgccg
cgaggtgcactggtgaggggcgcctacatggtcacttccttcttcactgatgacgacagg
gcagaccacctttcctgggagtggggactccacatctgccaagactggaagagctga

DBGET integrated database retrieval system