KEGG   Miniopterus natalensis: 107525363
Entry
107525363         CDS       T05883                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04151  PI3K-Akt signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna05162  Measles
mna05165  Human papillomavirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05206  MicroRNAs in cancer
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107525363 (CDKN1B)
   04066 HIF-1 signaling pathway
    107525363 (CDKN1B)
   04068 FoxO signaling pathway
    107525363 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    107525363 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107525363 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525363 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    107525363 (CDKN1B)
   05206 MicroRNAs in cancer
    107525363 (CDKN1B)
   05203 Viral carcinogenesis
    107525363 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    107525363 (CDKN1B)
   05220 Chronic myeloid leukemia
    107525363 (CDKN1B)
   05215 Prostate cancer
    107525363 (CDKN1B)
   05222 Small cell lung cancer
    107525363 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107525363 (CDKN1B)
   04934 Cushing syndrome
    107525363 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    107525363 (CDKN1B)
   05169 Epstein-Barr virus infection
    107525363 (CDKN1B)
   05165 Human papillomavirus infection
    107525363 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107525363 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 107525363
NCBI-ProteinID: XP_016052997
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASRRKW
NFDFQNHKPLEGRYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDAPGSRQAVPLAG
SQASSEDSRSVDPKTEEPDSQAGLAEPGAGMRKRXXXXDASTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtctaacgtgagggtgtctaacgggagcccgagcctggagcggatggacgccaggcag
gcggagtaccccaagccctccgcctgcagaaacctcttcgggccggtggatcacgaagag
ttaacccgggacctggagaagcactgccgagacatggaggaggcgagccggcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcagatacgagtggcaggaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgcccgcgcaggagagccaggacgcccccgggagccgccaggcggtgcctttagccggg
tcccaggcaagctcggaggactcgcgctcggtagaccccaagaccgaagagccggacagc
caggcgggcttagcggagccgggagctgggatgaggaagcgnnnnnnnnnnntagatgcc
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggctccgtggagcagacgcccaagaagccgggcctccggagacgtcaaacgtaa

DBGET integrated database retrieval system