KEGG   Miniopterus natalensis: 107525397
Entry
107525397         CDS       T05883                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
mna  Miniopterus natalensis
Pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04520  Adherens junction
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05132  Salmonella infection
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05221  Acute myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107525397 (TCF7)
   04390 Hippo signaling pathway
    107525397 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107525397 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    107525397 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107525397 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525397 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107525397 (TCF7)
   05225 Hepatocellular carcinoma
    107525397 (TCF7)
   05226 Gastric cancer
    107525397 (TCF7)
   05216 Thyroid cancer
    107525397 (TCF7)
   05221 Acute myeloid leukemia
    107525397 (TCF7)
   05217 Basal cell carcinoma
    107525397 (TCF7)
   05215 Prostate cancer
    107525397 (TCF7)
   05213 Endometrial cancer
    107525397 (TCF7)
   05224 Breast cancer
    107525397 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107525397 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107525397 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107525397 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107525397 (TCF7)
   05165 Human papillomavirus infection
    107525397 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107525397 (TCF7)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    107525397 (TCF7)
SSDB
Motif
Pfam: HMG_box CTNNB1_binding HMG_box_2 Peptidase_M13
Other DBs
NCBI-GeneID: 107525397
NCBI-ProteinID: XP_016053041
LinkDB
Position
Unknown
AA seq 269 aa
MYKDTVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPAHGVPQLSPLYEHFSSPHPTP
APADINQKQVHRPLQTSDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPH
PAIVPPSGKQELQPYDRSLKTQAESKEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLK
ESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQ
ESNTDPGSPKKCRARFGLNQQTDWCGPCR
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtacaaagacaccgtctactccgccttcaatctgctcatgcactacccacccccctcg
ggagcagggcagcacccccagccgcagcccccactgcacaacaaggccagtcagcctgcc
catggagtcccccaactctctcctctctatgaacatttcagcagcccacaccccacacct
gcaccagccgacatcaaccagaagcaagttcacaggcctctgcagacctctgacctctct
ggcttctactctctgacctcaggcagcatgggacagcttccccacactgtgagctggttc
acccacccatccctgatgctaggttccggagtacctggtcacccagcagccattccccac
ccggccattgtgcccccctcagggaagcaggaactacagccctatgatcgaagcctgaag
acgcaggcagaatccaaggagaaggaggccaagaagccaaccatcaagaagccactcaac
gccttcatgctgtacatgaaggagatgagagccaaggtcattgcagaatgcacactcaaa
gaaagtgctgccatcaaccagatcctgggccgcaggtggcacgcactgtcacgggaagag
caggccaagtattacgagctggcccgcaaggagaggcagctgcacatgcagctataccca
ggctggtcagcgcgggacaactacgggaagaagaagaggcggtccagagaaaagcaccaa
gaatccaacacagaccctggctcgcctaagaaatgccgtgctcgctttggcctcaaccag
cagacggattggtgtggtccgtgcagataa

KEGG   Miniopterus natalensis: 107528616
Entry
107528616         CDS       T05883                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
mna  Miniopterus natalensis
Pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04520  Adherens junction
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05132  Salmonella infection
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05221  Acute myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107528616 (TCF7L1)
   04390 Hippo signaling pathway
    107528616 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107528616 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107528616 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528616 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107528616 (TCF7L1)
   05225 Hepatocellular carcinoma
    107528616 (TCF7L1)
   05226 Gastric cancer
    107528616 (TCF7L1)
   05216 Thyroid cancer
    107528616 (TCF7L1)
   05221 Acute myeloid leukemia
    107528616 (TCF7L1)
   05217 Basal cell carcinoma
    107528616 (TCF7L1)
   05215 Prostate cancer
    107528616 (TCF7L1)
   05213 Endometrial cancer
    107528616 (TCF7L1)
   05224 Breast cancer
    107528616 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107528616 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107528616 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107528616 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107528616 (TCF7L1)
   05165 Human papillomavirus infection
    107528616 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107528616 (TCF7L1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    107528616 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 107528616
NCBI-ProteinID: XP_016057239
LinkDB
Position
Unknown
AA seq 556 aa
GANDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEAERRPQPSR
DAFQKPRDYFAEVRRPQDGAFFKGPPYPGYPFLMIPDLSSPYLPNGPLSPGGARTYLQMK
WPLLDVPSSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSSDHFSPGSPPTHLS
PEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYP
ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSAKS
PVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQ
AKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSK
KPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPETR
AQLALHSAAFLSAKAAATSSGQMGSQPPLLSRPLPLGSMPTALLTSPPSFPATLHAHQAL
PVLQAQPLSLVTKSAH
NT seq 1671 nt   +upstreamnt  +downstreamnt
ggggcgaacgacgagctgatccccttccaggacgaagggggcgaggagcaggagccgagc
agcgacagcgcctcggcgcagcgggacctggacgaggttaagtcgtccctggtcaacgag
tcggagaaccagagcagcagctcggactcggaggcggagaggcgcccgcagccctctcgg
gacgccttccagaagccgcgggactatttcgccgaagtgagaaggccccaggacggcgcg
ttctttaaggggcccccgtaccctgggtatccgttcctgatgatcccggacctgagcagc
ccgtatctccccaacggacccctgtctcccggaggagcgcgcacgtacctgcagatgaaa
tggcccctccttgatgtcccctccagtgctacagtcaaggataccaggtcaccgtcccca
gcacacttgtctaacaaagttcctgtcgttcaacaccctcatcacatgcacccgttgaca
cccctcatcacctacagcagcgaccacttttcccctggctcccctcccacccacctctcc
ccagagattgatccaaagacaggaatcccccggcctcctcacccatctgaactgtccccg
tattacccactgtctcctggagctgtcggacagatcccccaccccctcggctggctcgtc
ccacagcaaggacagcccatgtactcccttcctccgggtggcttccggcacccctaccct
gccctcgccatgaacgcctcaatgtccagcctggtttccagtcggttctcccctcacatg
gtggctccggcccatcctggtttgcccacctcagggattccccaccccgccatcgtctcc
cccatcgtcaagcaggagccggcaccccccagcctgagcccggccgtgagcgcgaaatca
ccagtcacggtgaaaaaggaggaagaaaagaaaccccacgtgaagaagcccctgaatgcc
ttcatgttatacatgaaggagatgagggccaaggtggtggccgagtgcaccctgaaggaa
agcgccgccatcaatcaaatcctgggcagaaagtggcacaacctgtcccgagaagaacag
gccaagtactatgaactggcccggaaggagcggcagcttcactcccagctctacccgacc
tggtcggcccgcgacaactatggtaagaaaaagaaaaggaagagagaaaagcagctgtcg
cagacacagtcccagcagcaagtccaagaggcagaaggtgctctggcctccaaaagcaag
aagccgtgtgttcagtacctgccccctgagaagccctgtgacagccctgcctcttcccat
ggcagcatgctggactccccggccaccccctccgcagccttggcctcgccggctgcccct
gctgcaacccactcggagcaagcccagcccctctccctcaccaccaagccagagacccgg
gcccagctggctcttcactcggctgccttcctgtcagctaaggctgcagccacgtcctct
ggccagatgggcagccagcccccgctcctctcccggcccctcccactcgggtccatgccc
acagctctgctgacttctcccccttccttccctgccacgctccatgcccaccaggccctc
ccagtactccaggcccagcctctttccttggtcaccaagtctgcccactaa

KEGG   Miniopterus natalensis: 107536455
Entry
107536455         CDS       T05883                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
mna  Miniopterus natalensis
Pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04520  Adherens junction
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05132  Salmonella infection
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05221  Acute myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107536455 (TCF7L2)
   04390 Hippo signaling pathway
    107536455 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107536455 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107536455 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536455 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107536455 (TCF7L2)
   05225 Hepatocellular carcinoma
    107536455 (TCF7L2)
   05226 Gastric cancer
    107536455 (TCF7L2)
   05216 Thyroid cancer
    107536455 (TCF7L2)
   05221 Acute myeloid leukemia
    107536455 (TCF7L2)
   05217 Basal cell carcinoma
    107536455 (TCF7L2)
   05215 Prostate cancer
    107536455 (TCF7L2)
   05213 Endometrial cancer
    107536455 (TCF7L2)
   05224 Breast cancer
    107536455 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107536455 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107536455 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536455 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107536455 (TCF7L2)
   05165 Human papillomavirus infection
    107536455 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107536455 (TCF7L2)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    107536455 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 107536455
NCBI-ProteinID: XP_016067631
LinkDB
Position
Unknown
AA seq 530 aa
MFVLFALQYLQMKWPLLDVQAGTLQSRQALKDARSPSPAHIVQCPLPCCTQGHDCQHLYP
PSDFTVSTQVFRDMKRSHSLQKVGEPWCLESNKVPVVQHPHHVHPLTPLITYSNEHFTPG
NPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTG
GFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVG
SLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWH
ALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPC
LSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDS
PPPSPGLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLALMPPPALLLAEAAHGKAPALCP
NGALDLPPALQPPVLPPSSVAQPSTSSVHSHGALAGPQPQPLSLVTKSLE
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgttcgttttgtttgctctccagtatttgcagatgaaatggccgctgcttgatgtccag
gcggggaccctccagagcagacaagccctcaaggatgcccgctctccgtcgccggcacac
attgtccagtgtcccctcccttgctgcactcagggacatgactgtcagcacctctacccc
ccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccactcctta
caaaaggttggggagccctggtgtttggagtcgaacaaagtgcccgtggtgcagcaccct
caccatgtccaccctctcacgcctcttatcacgtacagcaacgaacacttcacccccgga
aacccgcctccacacttaccagccgacgtagaccccaaaacaggaatcccacggcctccg
caccctccagacatatctccgtattacccgctctcgcccggcaccgtaggacaaatcccc
catccgctaggatggttagtaccacagcaaggtcagccagtgtacccaatcacaacagga
ggattccgccacccctaccccacagctctgactgtcaacgcttccatgtccagctttctg
tcttctaggttccctccccatatggtcccaccacatcacactctccatacgaccggcatc
ccccacccggccatcgtcacgccaacagtcaaacaggaatcctcccagagtgacgtcggc
tccctccacagctcaaagcatcaggactccaaaaaggaagaagaaaagaagaagccccac
ataaagaagcctcttaatgcgttcatgttgtatatgaaggaaatgagagcaaaggtggtc
gccgagtgcacgttgaaagagagcgcggccatcaaccagatcctgggtcggaggtggcac
gcgctgtcgagagaagagcaagcaaaatactacgagctggcccggaaggagcgacagctt
cacatgcagctgtaccccggctggtccgcacgggataactacgggaagaagaagaagagg
aaaagggacaagcagcccggggagaccaacgaacacagcgaatgtttcctaaatccttgc
ctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgctttggc
cttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgttcgctac
atacaaggtgaaggcagctgcctcagtccaccctcttcagatggaagcttactagactcg
cctcctccctcccccggcctgctaggctcccctccccaggacgccaagtcacagactgag
cagacccagccgctctcgctgtccctgaagcccgaccccctggcccacctggccctgatg
ccgccgcccgccctcctgcttgccgaggccgcccacggcaaggcccccgccctctgtccc
aacggggccctggacctgccccccgccctgcagccgcccgtcctgcccccctcctccgtc
gcccagccttcgacatcttccgtacattcccacggcgccctggccgggccccagccccag
ccgctctccctggtcaccaagtctttagaatag

KEGG   Miniopterus natalensis: 107538292
Entry
107538292         CDS       T05883                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04310  Wnt signaling pathway
mna04390  Hippo signaling pathway
mna04520  Adherens junction
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05132  Salmonella infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05221  Acute myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107538292 (LEF1)
   04390 Hippo signaling pathway
    107538292 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107538292 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107538292 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538292 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107538292 (LEF1)
   05225 Hepatocellular carcinoma
    107538292 (LEF1)
   05226 Gastric cancer
    107538292 (LEF1)
   05216 Thyroid cancer
    107538292 (LEF1)
   05221 Acute myeloid leukemia
    107538292 (LEF1)
   05217 Basal cell carcinoma
    107538292 (LEF1)
   05215 Prostate cancer
    107538292 (LEF1)
   05213 Endometrial cancer
    107538292 (LEF1)
   05224 Breast cancer
    107538292 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107538292 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107538292 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107538292 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107538292 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107538292 (LEF1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    107538292 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 107538292
NCBI-ProteinID: XP_016069984
LinkDB
Position
Unknown
AA seq 445 aa
MPQLSGAGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNES
EIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN
NDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSK
QGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSR
FSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDGDLMHVKPQHEQRKEQEPKRPHIKK
PLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQ
LYPGWSARDNYGKKKKRKREKLQESTSGRHRVTFQSILRPLTNTFEVVCIFLHTLLYSAA
VSCDTSTLLFLLKFFKDVSETFFSV
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgccccaactctcaggggcaggcggtggcgggggggacccggaactctgcgccacggac
gagatgatccccttcaaggacgagggcgatccccagaaggagaagatcttcgccgagatc
agtcaccccgaagaggaaggcgacttagccgacatcaagtcctccttggtaaacgagtct
gaaataatcccggccagcaacgggcacgaggtggccagacaagcacaaacctcgcaggag
tcctaccatgacaaggccagagaacaccctgatgacggcaagcatccagacggaggcctc
tacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatgaat
aatgacccatacatgtcaaatggatctctctctccacccattccgagaacatcgaataaa
gtgcccgtggtgcagccatcccatgcggttcatcctcttacccccctcatcacttacagc
gacgagcacttttctccaggatcccacccgtcacacatcccatcagatgtcaactctaaa
caaggcatgtccagacatcctcccgctcctgagatccctaccttttacccactgtctccg
ggtggagttggacagattaccccacctcttggctggcaaggtcagcctgtatatcccatc
acgggaggattcaggcaaccctacccatcctcactgtcagtcgacacttccatgtccagg
ttttcccatcacatgattcctggtccacctggtccccacacaactggcatccctcatcca
gctattgtgacacctcaggtcaagcaggagcacccccacactgacggtgacctgatgcac
gtgaagcctcagcatgaacagagaaaggagcaggagcccaaaagacctcacattaagaag
cctctgaatgcttttatgttatacatgaaagaaatgagagcaaatgtcgtggccgagtgt
acgctgaaagaaagtgcagccatcaaccagatcctaggcagaaggtggcatgccctctcc
cgggaagaacaggctaagtattatgaattagcgcggaaggaaagacagctacatatgcag
ctttatcctggctggtccgcaagagacaattatggtaagaaaaagaagaggaagagagag
aagctgcaggaatccacatcaggtaggcaccgtgtgacttttcagtccattctcaggcct
ctgacaaacacctttgaagtagtttgcatctttctacacacactgctttattctgcagct
gtatcttgtgatacttcaactctgcttttcctcctgaaattctttaaagatgtttcggag
accttcttttcagtgtga

DBGET integrated database retrieval system