KEGG   Miniopterus natalensis: 107525439
Entry
107525439         CDS       T05883                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
mna  Miniopterus natalensis
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04380  Osteoclast differentiation
mna04630  JAK-STAT signaling pathway
mna04910  Insulin signaling pathway
mna04917  Prolactin signaling pathway
mna04930  Type II diabetes mellitus
mna04935  Growth hormone synthesis, secretion and action
mna05145  Toxoplasmosis
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107525439 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107525439 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107525439 (SOCS1)
   04917 Prolactin signaling pathway
    107525439 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    107525439 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107525439 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107525439 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107525439 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107525439 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107525439 (SOCS1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     107525439 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 107525439
NCBI-ProteinID: XP_016053083
LinkDB
Position
Unknown
AA seq 232 aa
MSPHQRTPGTLWPTPPAGPACRMVAHNQVAADNAISTATEPRRRPEPSSSSSSPATPVRP
RPCPAVPAPSPGDTHFRTFRSHADYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVG
TFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPR
RMLGAXXXXXXXXXXQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtctccccatcagcgcacccccggaacgctatggcccacccctccggctggccccgcg
tgtaggatggtagcacacaaccaggtggcagccgacaatgcaatctccacggcaacagag
ccccgacggcggccagagccttcctcctcctcctcctcgcccgcgaccccggtgcgcccg
cggccctgcccggcggtcccggctccgtccccgggcgacacgcacttccgcacgttccgc
tcgcacgccgattaccggcgcatcacccgaaccagtgcgctccttgacgcttgcggcttc
tactgggggcccttgagcgtgcacggggcgcacgagcggcttcgcgccgagcccgttggc
accttcttggtgcgtgatagccgccagcggaactgcttcttcgctctcagcgtgaagatg
gcctcgggccccacgagcatacgcgtgcacttccaggctggccgcttccacctggacggc
agccgcgaaagcttcgactgcctcttcgagctgctcgagcactacgtggcggcgccgcgc
cgcatgctgggggcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncaggagctgtgtcgc
cagcgcatcgtggccaccgtgggccgcgagaacctggcgcgcatccccctcaaccctgtt
ctccgcgactacttgagctccttccccttccagatctga

KEGG   Miniopterus natalensis: 107532035
Entry
107532035         CDS       T05883                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
mna  Miniopterus natalensis
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04380  Osteoclast differentiation
mna04630  JAK-STAT signaling pathway
mna04668  TNF signaling pathway
mna04910  Insulin signaling pathway
mna04917  Prolactin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04935  Growth hormone synthesis, secretion and action
mna05160  Hepatitis C
mna05164  Influenza A
mna05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107532035 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107532035 (SOCS3)
   04668 TNF signaling pathway
    107532035 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107532035 (SOCS3)
   04920 Adipocytokine signaling pathway
    107532035 (SOCS3)
   04917 Prolactin signaling pathway
    107532035 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    107532035 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107532035 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107532035 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    107532035 (SOCS3)
   04931 Insulin resistance
    107532035 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107532035 (SOCS3)
   05164 Influenza A
    107532035 (SOCS3)
   05168 Herpes simplex virus 1 infection
    107532035 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107532035 (SOCS3)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     107532035 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box Exostosin
Other DBs
NCBI-GeneID: 107532035
NCBI-ProteinID: XP_016061772
LinkDB
Position
Unknown
AA seq 221 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGPPSFPSPPTEPTSEVPEQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSS
NVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 666 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcggtgcgcaag
ctgcaggagagcggcttctactggagcgcggtgacgggcggcgaggcgaacctgctgctc
agcgccgagcccgccggcaccttcctcatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctccctgcagagcgacccccgcagcacccagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcatcactacatgccgccccccggccccccctccttcccctcgccaccc
actgaacccacctctgaggtgccagaacagccgctcccggggagcccccccaggagagcc
tattacatctactccgggggcgagaagatcccgctggtgttgagccggcccctctcctcc
aacgtggccactctccaacatctctgtcggaagaccgtcaacggccacctggactcctac
gagaaggtcacccagctgcccggacccattcgggagttcctggaccagtacgatgctcca
ctttaa

KEGG   Miniopterus natalensis: 107538918
Entry
107538918         CDS       T05883                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
mna  Miniopterus natalensis
Pathway
mna04630  JAK-STAT signaling pathway
mna04910  Insulin signaling pathway
mna04917  Prolactin signaling pathway
mna04930  Type II diabetes mellitus
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107538918 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107538918 (SOCS2)
   04917 Prolactin signaling pathway
    107538918 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    107538918 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107538918 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107538918 (SOCS2)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     107538918 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 107538918
NCBI-ProteinID: XP_016070755
LinkDB
Position
Unknown
AA seq 198 aa
MTLRCLEPSGNGAEGTRSQWGTAGSSEESSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKRTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgccttgagccctccgggaatggcgcggaagggacgcggagccagtgg
gggacggcggggtcctcggaggagtcgtccccggaggcagcgcgcctggcgaaggccttg
cgggagctcagtcaaacaggttggtactggggaagcatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaacttttttgattagagatagttcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatctccgaatcgagtatcaa
gatgggaaattcagattggactctatcatatgtgtcaagtccaagcttaaacagtttgac
agtgtggttcatctgatagactactatgttcagatgtgcaaggataagcggacgggccca
gaagccccccggaacggcactgttcacctttatctgaccaaaccgctctacacatcagca
ccacctctgcagcatctctgcagactcaccattaacaaacgcaccggtgccatctgggga
ctgcctttgccaacaagactaaaagattacttggaagaatataaattccaggtataa

DBGET integrated database retrieval system