KEGG   Miniopterus natalensis: 107525454
Entry
107525454         CDS       T05883                                 

Definition
(RefSeq) putative speedy protein-like protein 3
  KO
K08694  speedy
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107525454
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107525454
SSDB
Motif
Pfam: Spy1 pXO2-72
Other DBs
NCBI-GeneID: 107525454
NCBI-ProteinID: XP_016053099
LinkDB
Position
Unknown
AA seq 239 aa
MAQDKWVVETLCGLKVKSKRQRVSSLLPEHHEALTRLLAPCGEWGPLPQPAGLKRKREWS
SEETEAAAPQARDKWVVETLCGLKMKLKRQRASSVLPEHHEAFTRLLEDPVIKRFLDWDK
NLRISDKYLLSMVIAYFSRAGLFPWQYQRIHFFLALYLALDMEENDEAPKQAIFPFLSGE
SNCPQRPWFHKLRFQFFCSMGWRARVTREECEEIQAFDPKLWVWGRDRALLPETTKPKE
NT seq 720 nt   +upstreamnt  +downstreamnt
atggctcaggacaagtgggtcgtggagacgctgtgtgggctcaaggtgaagtcaaagagg
cagcgggtgtcttcattgctacctgagcaccatgaggccctcaccaggctgctcgccccc
tgtggagagtggggtcccctgcctcagcctgcgggcctgaagagaaagagggagtggtca
tcagaggagacagaggcggccgccccccaggctcgggacaagtgggtcgtggagacactg
tgtgggctcaagatgaagctgaagaggcagcgggcgtcttcagtgctacctgagcaccac
gaggccttcaccaggctgctcgaggatcctgtcattaaaagattcctggactgggacaaa
aacctgaggatctcggacaagtacctcctgtccatggtgatagcgtatttcagccgtgcg
ggcctctttccctggcagtaccagcggatccacttcttcctggccctctacctagccctt
gacatggaagagaatgacgaggcccctaaacaggccatcttccccttcctctctggggag
agcaactgcccgcagcgcccctggttccacaaactgcgattccagttcttctgttccatg
ggctggagggcgcgggtcacgcgggaagagtgcgaggagatccaggcttttgacccaaag
ctctgggtgtgggggcgagatcgtgccctccttcctgagaccaccaagcctaaggaatag

KEGG   Miniopterus natalensis: 107533551
Entry
107533551         CDS       T05883                                 

Gene name
SPDYC
Definition
(RefSeq) speedy protein C
  KO
K08694  speedy
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107533551 (SPDYC)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107533551 (SPDYC)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 107533551
NCBI-ProteinID: XP_016063772
LinkDB
Position
Unknown
AA seq 312 aa
PYEMSEAQDPAHVVAIQVELWGWSRQDGGTGALHPCQHPELQAFLSLLEHSFLQEFLSRD
PCFQISDKYLLAMVLVYFRRANLKLSEYTCSNLFLALYLANDMEEDLEDAKCMIFPWALG
KDWPSQVTDFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPSHWAWTRERRPHHGGAQRSC
PKARITLPRGPGFSPPHCSLCGLPPLYNHSCHQPRLLPVLPKCPSPNPEWYCPRSLSCFS
VAEDSWGAGFFMVLPLQLHLEPGTYTLHSWQCCPRPLHPPPNLQLVSTVTLSPYNKLMST
GHQLCLGPGLAP
NT seq 939 nt   +upstreamnt  +downstreamnt
ccctatgagatgagtgaagcccaagaccctgcccatgtggttgccatccaggtggagctg
tggggctggagccgtcaagatgggggcactggggctctccatccctgccagcacccagag
ctccaggccttcctcagccttctggagcacagtttccttcaggaattcctctccagagat
ccctgtttccagatttcagataagtatctcctggccatggtgctcgtctacttccggcgc
gccaacctgaagctcagcgagtacacctgcagcaacctgttcttggcactgtaccttgca
aatgatatggaggaggacctggaggatgccaaatgtatgatttttccatgggccctgggc
aaagattggcctagtcaggtgacagacttcctgcatcagagggacaaactgtgggcaagg
atgggcttccgggccgtcgtgagccgccagtgctgtgaggaggtcatggccaaggagccg
tcccactgggcctggactcgggagcggcgcccccaccacggcggggctcagaggagctgc
ccaaaggcccggatcaccctccccaggggccccggcttctcaccgccccactgttccctc
tgtggcttgccccctctctataaccactcctgccaccaaccccgcctgttgcctgtctta
cccaaatgtccttccccaaaccctgagtggtactgccctcgttccctctcttgtttctca
gtggctgaagactcctggggtgcgggcttcttcatggtcctgcccttgcagctgcatctg
gagccaggcacctacaccctccacagctggcagtgctgcccaaggcccctgcaccctcct
cccaacctgcaacttgtatccactgtgactctgtccccctataataaactcatgtccaca
ggacaccaactgtgcttaggccctggcctggctccttga

KEGG   Miniopterus natalensis: 107534707
Entry
107534707         CDS       T05883                                 

Gene name
SPDYA
Definition
(RefSeq) speedy protein A isoform X1
  KO
K08694  speedy
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107534707 (SPDYA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107534707 (SPDYA)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 107534707
NCBI-ProteinID: XP_016065361
LinkDB
Position
Unknown
AA seq 313 aa
MRHNQLCCETPPTVTVHVKSGSSRSHQPKKPINLKRPIFKDSWPASEKNAQNSNKSKRPK
GPCLVIQRQEMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTINEHTR
INFFIALYLANTVEEDEEESKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKGRYVRL
GLSSSSSLSSDTVEVIEKHSQESHNSFSMGTIVDPSQAYSYPQVANDHQSNKEKKTNFMK
TDKSMEWFTGSEE
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaggcataatcagctgtgttgtgagacaccacctactgtcactgttcatgtaaaatct
gggtcaagtagatcacatcagcctaaaaaacctattaatctgaagcgtcctatttttaaa
gatagttggccagcatctgaaaaaaatgcgcagaatagcaacaagtctaaacgcccgaaa
ggaccctgtctagttatacagcgacaggaaatgactgctttctttaaattatttgatgac
gatttaattcaagatttcttgtggatggattgctgctgtaaaattgcagacaagtatctt
ttggctatgacctttgtttatttcaagagggctaaatttactataaatgagcataccagg
ataaatttctttattgctctgtatctggctaatacagttgaagaagacgaagaagaatcc
aaatatgaaatttttccatgggctttagggaaaaactggagaaaattgttccccaatttc
ttaaagttaagggaccaactgtgggatagaattgactatagggctattgtaagcaggcga
tgctgtgaggaggttatggccattgctccaacccattacatatggcaacgagaacgttct
gtgcatcacagtggagctgttagaaactacaacagagatgaagttcaactgcccagggga
cctagtgccacaccggtagattgctcactctgtggtaaaaaaggaagatatgttagactg
ggattgtcttcatcatcatctttatccagtgatacagtagaggtgatagaaaaacattct
caggaatcacacaactcattctcaatgggcacaatagttgatccttctcaagcttatagt
tatcctcaagtagccaatgaccatcaatcaaacaaagaaaagaaaactaatttcatgaag
acagacaaatctatggagtggtttacaggcagtgaagaatga

KEGG   Miniopterus natalensis: 107537580
Entry
107537580         CDS       T05883                                 

Definition
(RefSeq) speedy protein E4-like
  KO
K08694  speedy
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107537580
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107537580
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 107537580
NCBI-ProteinID: XP_016069108
LinkDB
Position
Unknown
AA seq 258 aa
MASCEPSFPSGNRSPQPNSSGDPLEVRADEAAPGPPGPKRKRERSADAGPEEEAAPGAQD
AWAVETLCGLKMKLKRQRACPVLPEHHAAFARLLEDPVVKRFLAWDKNLRVSDKYLLSMV
VAYFSRAGLFSWQYQRIHFFLALYLANDMEEDSQAPKRAIFSFLYGRDRSPRALFHRLRF
QLFRSMGWRMRVSREECEQIQAFDPELWVWGRDRALLSQAPGPQIAEPRGDSRIQQEVNP
DANGRSEEGKEDPPVQII
NT seq 777 nt   +upstreamnt  +downstreamnt
atggccagttgtgaaccgagtttcccgtctgggaaccggagccctcagcctaactcctcg
ggggaccccctggaggtgagagcggatgaagcagccccaggaccaccaggcccgaagagg
aagagggagcggtcagcagatgcggggcccgaggaggaggcagcccctggggctcaggac
gcctgggccgtggagacgctgtgcgggctcaagatgaagctgaagaggcagcgggcgtgc
cccgtgctgcccgagcaccacgcggccttcgccaggctgctcgaggatcctgttgttaaa
agattcctggcctgggacaaaaatctgagagtgtctgacaagtacctcctgtccatggtg
gtagcttatttcagccgcgccggcctcttctcctggcagtaccagcggattcatttcttc
ctggcgctctacctggccaacgacatggaggaggacagccaggccccgaagcgggccatc
ttctccttcctctacgggagggaccgctccccgcgcgccctgttccacaggctgcgcttc
cagctcttccgctccatgggctggaggatgagggtctcccgggaagagtgcgagcagatc
caggcttttgacccagagctctgggtgtgggggcgagatcgtgctctcctttcccaggcc
ccgggccctcagattgctgagcccaggggagactcgaggattcagcaggaggtcaatcca
gatgctaatggcaggagtgaggaagggaaagaggaccctcctgtgcagatcatctag

DBGET integrated database retrieval system