KEGG   Miniopterus natalensis: 107525521
Entry
107525521         CDS       T05883                                 

Gene name
IRS1
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04068  FoxO signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna05010  Alzheimer disease
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107525521 (IRS1)
   04022 cGMP-PKG signaling pathway
    107525521 (IRS1)
   04151 PI3K-Akt signaling pathway
    107525521 (IRS1)
   04152 AMPK signaling pathway
    107525521 (IRS1)
   04150 mTOR signaling pathway
    107525521 (IRS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107525521 (IRS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107525521 (IRS1)
   04923 Regulation of lipolysis in adipocytes
    107525521 (IRS1)
   04920 Adipocytokine signaling pathway
    107525521 (IRS1)
   04935 Growth hormone synthesis, secretion and action
    107525521 (IRS1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107525521 (IRS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107525521 (IRS1)
  09149 Aging
   04211 Longevity regulating pathway
    107525521 (IRS1)
   04213 Longevity regulating pathway - multiple species
    107525521 (IRS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107525521 (IRS1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107525521 (IRS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107525521 (IRS1)
   04932 Non-alcoholic fatty liver disease
    107525521 (IRS1)
   04931 Insulin resistance
    107525521 (IRS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107525521 (IRS1)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   107525521 (IRS1)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 107525521
NCBI-ProteinID: XP_016053191
LinkDB
Position
Unknown
AA seq 1226 aa
MASPPETEGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKSH
HDGAAXXXXXXXXXGAGGGSCSGGSGVGEAGEDLGFGDPGPAFKEVWQVILKPKGLGQTK
NLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFW
MQVDDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQV
GLTRRSRTXXXXATSPASLVGAKQGSFRVRASSDGEGTMSRPASVDGSPVSPSANRTHAH
RHRGAARLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVS
GSPSDGGFISSDEYGSSPCDFRNSFRSVTPDSLGHTPPARGEEELSHYICMGGKGASALA
APNGHYILPRGGNGHRYLPGTSPALAGEDAASAAELDNRFRKRTHSAGTSPTISHQKTPS
QSSVASIEEYTEMMPAYPPGGGGGGRLPGHRHSAFVPTQSYPEEGLETHPSERRAGHSRP
DAATLHTDDGYMPMSPGVAPVPSSRKGSGDYMPMSPKSVSSPQQIVNPARRHPQRVDPNG
YMMMSPSGSCSPDTGGGPGGNSGAAPSGSGCGKLWTNGVGGHHSHAAPHPKPPLESGGGK
LLSCTGDYMNMSPAGDSNASSPSDCYCGPEDPQHKPVLSYYSLPRSFKHTQRPGDPEEAA
RPQHLRLSSSSGRLLYAAAADDSSSSTSSDSLGGGCWGARPEPGLPHHLHHQALQPHLPR
KVDTAAQTNSRLARPTRLSLGDPKASTLPRAREPQQPALLHPPEPKSPGEYVNIEFGSDQ
PGYFSGPVASHGSPSVRCPPQLQPAPREEESGTEEYMNMDLGPGRRATWQESPGAPPSRV
GPAPPGTAGTCRPTRAVPGDRGDYMTMQAGCAHQSYVDTSPAAPVSYADIRTGVVEEASL
PGATAAAPPSPAAASAPPTAPQGAGALEAPQGPGGASAFTRVSLHPSGSQSARVIRADPQ
ACRRRHSSETFSASPSTPQAGNPAPLAGGAAVGGGGGGAEDVKRHSSASFENVWLRPGER
GGAPKEPAHACGAAGGLENGLNYIDLDLVKDFKQRPQEHPRQAQAPPAPAPHQALGSGES
SSGRRAREDVSTYASISFQKQPEDLQ
NT seq 3681 nt   +upstreamnt  +downstreamnt
atggcgagccctccggagaccgaaggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaagcgcttcttcgtgctgcgggcggccagcgaggcgggcggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggaggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgcttcaacatcaacaagcgggccgactccaagaac
aagcacctggtggccctctacacgcgggacgagcacttcgccatcgcggccgacagcgag
gcggagcaggacagctggtaccaggccctcctgcagctgcacaaccgcgccaagagccac
cacgacggcgccgcnnnnnnnnnnnnnnnnnnnnnnnnnnngggggcggggggcggcagc
tgcagcggcggctccggcgtcggcgaggccggggaggacctgggcttcggggacccaggg
cccgcgttcaaggaggtctggcaggtgatcctgaaacccaagggcctgggccagacaaag
aacctgatcggcatctaccgcctctgcctgaccagcaagaccatcagcttcgtgaagctg
aactcggaggcggcggccgtggtgctgcagctgatgaacatccggcgctgcgggcactcg
gagaacttcttcttcatcgaggtgggccgctccgccgtgaccgggcccggggagttctgg
atgcaggtggatgactcggtggtggcccagaacatgcacgagacgatcctggaggccatg
cgggccatgagcgacgagttccggccgcgcagcaagagccagtcttcctccaactgctcc
aaccccatcagcgtcccgctgcgccgccaccacctcaacaaccccccgcccagccaggtg
gggctgacgcgccgctcgcgcacnnnnnnnnnnnccgccacgtcccccgccagcctggtg
ggcgccaagcagggctccttccgcgtgcgcgcctccagcgacggcgagggcaccatgtcg
cgccccgcgtcggtggacggcagccccgtgagcccgagcgccaacaggacgcacgcgcac
cggcaccggggcgccgcccggctgcacccgccgctcaaccacagccggtccatccccatg
ccgtcctcccggtgctcgccttcggccaccagccccgtcagcctgtcgtcgagcagcacc
agcggccacggctccacctccgactgtcttttcccgcggaggtcgagcgcttccgtgtcg
ggctcgcccagcgacggcggcttcatctcctcggacgagtacggctccagtccctgcgat
ttccgaaattccttccgcagcgtcaccccggactcgctgggccacaccccgccggcgcgc
ggagaggaggagctgagccactacatctgcatggggggcaagggggcctcggccctcgcc
gcccccaacggccactacatcctgcctcgcggcggcaacggccaccgctacctcccgggc
accagccccgcgctggccggcgaggacgccgccagcgcggccgagctggataaccggttc
cgaaagcggacgcactcggcgggcacgtcccccaccatctcccaccagaagacgccctcg
cagtcctccgtggcgtccatcgaggagtacacggagatgatgcccgcctacccgccagga
ggtggcggtggaggccggctgcccggccaccggcactccgccttcgtgcccacccagtcc
taccccgaggagggcctggaaacccacccctcggagcgccgcgcaggccacagccgcccg
gacgccgccaccctgcacacggacgatggctacatgcccatgtcccccggcgtggccccg
gtgcccagcagccggaagggcagtggggactacatgcccatgagtcccaagagtgtgtct
tccccacagcagatcgtcaaccccgccaggcgccatccccagagggtggaccccaatggc
tacatgatgatgtcccccagcggcagctgctcccccgacaccgggggtgggcccggcggc
aacagcggcgctgccccctccgggagcggctgcgggaagctgtggacaaacggcgtcggg
ggccaccactcgcatgccgcgccacaccccaaaccgcccctggagagcggcggtggcaag
ctcttgtcttgcacgggtgactacatgaacatgtcgccggcgggggactccaacgccagc
agcccctccgactgctactgtggccccgaggacccccagcacaagccggttctctcctac
tactcactgccaaggtcctttaagcacacccagcgcccgggggacccggaggaggccgcc
cggccccagcacctccgcctctcctccagctccggtcgccttctctacgccgcggcggcc
gacgattcctcctcctccaccagcagcgacagcctgggcgggggatgctggggggcgagg
cccgagcccggcctcccgcatcatctgcaccatcaggccctgcagccgcatctgccgcga
aaggtggacacagctgcgcagaccaacagccgcctggcccggcccacgaggctgtccctg
ggggaccccaaggccagcaccttacctcgggcgcgggagccgcagcagccggccctgctg
caccctccggagcccaagagcccaggggagtatgtgaatatcgaatttgggagtgatcag
cctggctacttctccggtcccgtggcctcccacggctcgccttcggtcaggtgtccgccc
cagctccagccagcgcccagggaggaagagtccggcactgaagagtacatgaacatggac
ctggggcccggccgcagggccacctggcaggagagccctggggccccgccgagcagagtg
ggccccgcgcccccggggactgctggcacgtgcaggcccacccgggcagtgcccggcgac
cggggggactacatgaccatgcaggcgggatgtgcccatcagagctacgtggacacctct
ccggctgcgcctgtcagctacgctgacattcggacgggcgtcgtggaggaggcgagcctt
cccggggccacggcggccgctcccccctcacctgcggcagcctctgcgccccccaccgcg
cctcagggagcaggggcgctggaggccccgcaggggcccgggggcgcgagtgccttcacc
cgggtgagcctccatcccagcggcagccagagtgccagagtgatccgtgcggacccgcaa
gcctgtcggaggcggcacagctccgagaccttctccgcctcgcccagcaccccccaggcg
ggcaacccggcgcccctggcagggggcgctgcagtggggggcggcggcggcggcgctgag
gatgtgaaacgtcacagctctgcttcttttgagaacgtgtggctgaggcctggggagcgc
gggggggcccccaaggagcccgctcacgcgtgtggggctgccgggggtttggagaatggc
ctcaactacatcgacctggatttggtcaaggacttcaaacagcgccctcaggagcacccc
cgccaagcgcaggcgcccccagccccagcccctcaccaggctctgggcagcggagagagc
agctccggccgccgcgccagggaagatgtgagcacctacgccagcatcagtttccagaag
cagccagaggacctccagtag

KEGG   Miniopterus natalensis: 107526265
Entry
107526265         CDS       T05883                                 

Gene name
IRS4
Definition
(RefSeq) insulin receptor substrate 4
  KO
K17446  insulin receptor substrate 4
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04068  FoxO signaling pathway
mna04140  Autophagy - animal
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04910  Insulin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04930  Type II diabetes mellitus
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107526265 (IRS4)
   04022 cGMP-PKG signaling pathway
    107526265 (IRS4)
   04152 AMPK signaling pathway
    107526265 (IRS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107526265 (IRS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107526265 (IRS4)
   04923 Regulation of lipolysis in adipocytes
    107526265 (IRS4)
   04920 Adipocytokine signaling pathway
    107526265 (IRS4)
   04935 Growth hormone synthesis, secretion and action
    107526265 (IRS4)
  09149 Aging
   04211 Longevity regulating pathway
    107526265 (IRS4)
   04213 Longevity regulating pathway - multiple species
    107526265 (IRS4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107526265 (IRS4)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107526265 (IRS4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107526265 (IRS4)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   107526265 (IRS4)
SSDB
Motif
Pfam: IRS PH_11 PH PH_8
Other DBs
NCBI-GeneID: 107526265
NCBI-ProteinID: XP_016054166
LinkDB
Position
Unknown
AA seq 1274 aa
MASCSFARDQVTRRLRTAAAATATALAAVATTPLLSSGTPTALIGTGSSCPGAMWLSTAT
GSRSHSESDEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRH
SVRAAAAAAAAAASGTAAPALIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGTPCAQLEGEPASLGAVAAAEPPFYKDVWQVVVK
PRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDCVVAQNMHELFLKKMRALCADEYRARCRSYSISIGAHLLTLLSTRRH
LDMLPLEPGGWLRRSRFEQFCHLKAIGDGEDEMLLTRHSVPPREPVPHSRRGRLHLPRER
RSRRAISVPASFFRRLAPSPVHAQQPAETPSNRACGFSEASSSGSGNSAEEGNCQGQEGQ
EGSPGDYMPMNNWGSGNGWGSGGGQGSSGQGSSSQSSGGNQCSGTGKGFRGGHGSSGGQG
SSSQGSGAEGAGGHQCSGDGQGPAGGHGSGSGQGASGGHGSGSGQGPGDGHSSGGGKNSG
GSKGSGSGKDSDRNGERAKSLKRRSYFGKLIQSKQQQLPPPPPPPPPPAPAGATGGKGKS
GGRFRLYFCADRAATKEHKEAKEVKDAETLEGAAWGPQRAFDEDEDDPYMPMRPGVAAPL
ESSSDYMPMAPQNVSASIKCHSRSPFEDSRGYMMMFPRVTPPPAPVPPKASDPDKKDDCK
DNDSDSDYMFMAPGAGAIPKPPQNPQGGSSSKSWSSYFSLPNPFRSYPLGQSDHSEYVPM
LSGKLLGKGLDKEAVSIRGPKYSASTPSVEGFEAALQSFSKPGDEDSPSKPLDDGSPKDK
AKRPNRHFFITKGNKIEAKPQKSTHEQKEADSSSDYINFDFTKRSSNTPAPFIQGLPHLS
GIIANPRQSPFSHYMNIEFRVPFRNAGNILSNILRAIPGANRFFLDGARWPLLPLLTCAT
GSNAHEEGCEYIEVMFNPAMTPALSFGDRAIRYDAETGRIYVVDPFSECCMNTSLYPSHC
SEPPPVARLLQEEELERRRPQSFSQSIFESARAAVSAFPTDSLERDLSASLGSAAAVVPA
PTLPVGPALAAASTLPATPGMGAAALGFEAAPGFNSASVRWFQPVANAAGAEAVRGARVD
AGGSNPRSRNPSADLARDENGANRAAFAAAAPPLPPRHWLPRLPAREDSDEDDPYVRMDF
ARPEDKKFDSPPKE
NT seq 3825 nt   +upstreamnt  +downstreamnt
atggcgagttgctccttcgctcgagaccaagtgacaaggagactgagaactgcagcagcg
gctacagctacagctctagctgcagtggcgaccaccccacttctttcctcgggaacccca
accgcactcattgggaccgggtcttcttgtccgggagccatgtggctctccacggccact
ggctcccggtcacactccgagtccgatgaagaggacctccccgtcggcgatgaagtctgc
aaacgcggctacctgcggaagcagaagcatgggcacaggcgctacttcgtactcaaacta
gagaccgccgacgccccagctcggctggaatactacgaaaatgccaggaagttccggcac
agtgtccgcgctgcggcggctgcagcagcggcggccgcctcgggcaccgcggctccggct
ctcatcccaccgcggcgcgtgatcaccctgtaccagtgcttttcggtgagccagcgagcc
gacgcaaggtaccgacacctcatcgctcttttcacccaagatgagtacttcgctatggtg
gccgaaaacgagtcagagcaagagagctggtacttgctgctcagccgcctcatcctcgag
agcaagcgccgccgctgcggcacaccctgcgcacagctggagggagagccggcctcgctg
ggggcggtagcggcggcggagccacccttctacaaagatgtgtggcaggtagtagtcaaa
cccagggggctggggcatagaaaagagctgagcggcgtgttccggctctgtcttaccgac
gaggaggttgtatttgtgaggctgaataccgaagtggccagcgtggtcgtccagctcctg
agcatccgtcgctgtgggcactctgagcagtatttcttcttggaagtcggtaggtccacc
gtcatcggtccgggggagctctggatgcaggtcgatgactgtgtggtggcccaaaacatg
catgagctctttttgaagaagatgagagccttatgtgcagacgaataccgcgcccgctgc
cgaagctacagcatcagcatcggggcccacctgttaaccctgctgtccactaggaggcac
ctggacatgctgccgctggagcccggcggctggctcagaaggtcccgctttgagcagttt
tgccacctcaaggccatcggtgacggggaggacgagatgctccttaccaggcactccgta
ccacccagagagcctgttccccactccaggagaggaagactgcacctgcccagagagcgc
aggtccaggagagcgatttcagtgccagccagctttttccgacgcctagcacccagccca
gtgcatgctcagcagcctgcagaaacccccagcaacagagcttgcgggttttctgaagca
tctagttccggttctggcaactctgcagaagaaggcaactgtcaaggccaggagggtcag
gaaggaagcccaggtgactacatgcccatgaacaattggggctcaggaaatggctggggc
tcaggaggtggccagggctcaagtggccaaggctccagtagccagagctcaggaggaaac
cagtgctcaggcacagggaagggcttccgaggtggccacggctccagtggtggccagggt
tcaagcagccagggctcaggggccgagggtgcaggaggacaccagtgttcaggagatggc
cagggccctgcaggtgggcatggttcaggcagtggccagggagctagtggtgggcacggc
tcaggtagtggccaaggaccaggagatggccatagctcaggtggtggtaagaactctgga
gggagcaaaggctcaggaagtgggaaagactctgatcgcaatggtgaaagggcaaaatct
ctgaagagaagatcctactttggcaaattaattcaaagcaaacaacagcaactgccacca
cctccaccacctccacctccaccagcaccagctggagcaactggtggaaaagggaagtct
gggggaagattccggctttatttttgtgctgacagagcagccacaaaagagcacaaagaa
gccaaagaagtcaaagatgcagagaccctggaaggtgcagcttggggtccccaaagagct
tttgatgaagacgaggatgacccatacatgccaatgagaccaggggtggctgcccctctg
gaaagctccagtgattatatgccaatggctcctcaaaatgtttctgcttcaataaagtgc
cactctcgatccccttttgaagattcaagagggtacatgatgatgtttcctagagtaacc
ccaccacctgccccagttcctccaaaagcatctgatcctgataaaaaggatgactgtaag
gacaatgacagtgacagtgattacatgtttatggctcctggagccggtgcaattccaaaa
ccaccccaaaatcctcagggaggctcttcctccaaaagttggagctcctacttctctctg
ccaaatccttttcggagctacccattgggacagagtgaccacagtgagtatgtaccaatg
ttatctggaaaactcctggggaagggcctagacaaagaagcagtgtcaatcaggggaccc
aaatattcagcttcaacgccttcagttgagggctttgaagctgccctccagtcgttctca
aagcctggagatgaggattcaccttcaaagcctttagatgatgggtcccccaaggacaag
gctaagagacctaaccgacatttttttattacaaaaggaaataaaatcgaggcaaaaccc
caaaagtccacacatgaacagaaagaggctgacagctctagtgactacatcaactttgac
ttcactaaaagaagtagcaatacaccagccccctttattcaaggactgccacatttgtct
ggcataattgctaaccccagacagtcacccttttctcattacatgaatattgagttcaga
gtgccatttcgaaatgcaggaaacatcctctcaaatattttaagagctattccaggtgcc
aaccgcttctttctggacggtgctaggtggccacttctgcctcttcttacctgtgctaca
ggtagcaatgctcatgaggaagggtgtgagtacattgaagtgatgttcaacccagcaatg
acaccagccttgtcttttggtgaccgtgccattcgctatgatgctgaaacaggtcgaatc
tatgtggtcgacccattttctgagtgctgtatgaacacttctctctaccccagccactgc
tccgaaccaccacctgtagctaggctgctgcaggaagaagaactggagagaagacgccca
caaagcttttcgcaaagtatctttgaatccgccagagctgctgtctcggctttcccaacc
gacagcctggagagagacctctctgcctccttaggctctgccgcagcggtggtcccagcg
cccaccttacccgtgggtccggctctagccgccgcctccaccctccccgcgacccccggc
atgggcgcagccgccttgggcttcgaggctgcccctggatttaactctgcctccgtccgc
tggttccaacctgtagctaatgctgctggtgccgaagcggtaaggggtgcccgggtcgat
gctggtggttcgaaccctagatccagaaacccatctgcagaccttgccagagatgagaac
ggggctaacagggctgcttttgcagctgccgctcccccactaccacctcgccactggttg
ccgagactccccgcgcgagaagattctgacgaagatgacccgtacgtgagaatggacttt
gccagacctgaggacaagaagttcgactctcccccaaaagagtga

KEGG   Miniopterus natalensis: 107530378
Entry
107530378         CDS       T05883                                 

Gene name
IRS2
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor substrate 2
  KO
K07187  insulin receptor substrate 2
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04068  FoxO signaling pathway
mna04140  Autophagy - animal
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04910  Insulin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107530378 (IRS2)
   04022 cGMP-PKG signaling pathway
    107530378 (IRS2)
   04152 AMPK signaling pathway
    107530378 (IRS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107530378 (IRS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107530378 (IRS2)
   04923 Regulation of lipolysis in adipocytes
    107530378 (IRS2)
   04920 Adipocytokine signaling pathway
    107530378 (IRS2)
   04935 Growth hormone synthesis, secretion and action
    107530378 (IRS2)
  09149 Aging
   04211 Longevity regulating pathway
    107530378 (IRS2)
   04213 Longevity regulating pathway - multiple species
    107530378 (IRS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107530378 (IRS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107530378 (IRS2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107530378 (IRS2)
   04932 Non-alcoholic fatty liver disease
    107530378 (IRS2)
   04931 Insulin resistance
    107530378 (IRS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107530378 (IRS2)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   107530378 (IRS2)
SSDB
Motif
Pfam: IRS
Other DBs
NCBI-GeneID: 107530378
NCBI-ProteinID: XP_016059626
LinkDB
Position
Unknown
AA seq 654 aa
MTPGKKAHDPGAGEGHPGRVGHREPPATSGAWGWWRRAPSRTPALLPGRGTKLLSIPSSP
VTNVMLVNKLQARHQGTTQAQTRCGGRARAHPEPGRGIRSPKCPKGLGQSKNLTGVYRLC
LSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVA
QNIHETILEAMKALKELFEFRPRSKSQSSGSSATHPISVPGARRHHHLVNLPPGSPLSPG
SVRTPLSRSHTLSAGCGNRASKVTLAPAGGALQHSRSMSMPVAHSPPAATSPGSLSSSSG
HGSGSYPXXXXXXXXLPHPLHHHAGQRPSSGSASASGSPSDPGFMSLDEYGSSPGDLRAF
CSHRSNTPESIAETPPARDGSGSELYGYMTMDRPLSHCGRPYRRVSGDCAQDLDRGLRKR
TYSLTAPARQRPVPQPSSASLDEYTLMRATFSGSSSRLCPSCPTSSPKVAYHPYPEDYGD
IEIGSHRSSSSNLGTDDGYMPMTPGVALMGGGSGSCKSDDXAGRAFPGNGASCKAGSPAE
SSPEDSGYMRMWCGSKLPVEGPDSKLLPNGDYLNMSPSDAGTSGAPLDFFSAALHGGGEM
LRSVPGYCYSSLPRSYKAPYTCNGDNDQYVLMSSPVGRILEEERPAPPASVGPA
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgacgcccggcaaaaaagcccacgacccgggtgcgggggaaggacaccccgggcgcgtg
gggcaccgggaaccacccgcgaccagcggggcctggggttggtggcgccgcgccccctcc
cgtaccccggctctccttccaggaaggggcacgaagctgctatcgatcccgagctcaccg
gtgactaatgtgatgctcgtaaacaagctgcaggcgcggcaccagggaaccacccaggcg
cagacccgctgcggcgggcgagcgcgcgcccaccctgagcccgggcgcgggatccgctcg
cccaagtgtcccaagggcctgggccagagcaagaacttgacaggcgtgtaccgcctgtgc
ctgtccgcgcgcaccatcggcttcgtgaagctgaactgcgagcagccgtcggtgacgctg
cagctcatgaacatccgtcgctgcggccactcggacagcttcttcttcatcgaggtgggc
cgctcggcggtcaccggcccgggcgagctgtggatgcaggccgacgactcagtggtggcc
cagaacatccacgagaccattctggaggccatgaaggcgctcaaggagctctttgagttc
cggccgcgcagcaagagccagtcgtcggggtcgtcagccacgcaccccatcagcgtcccg
ggcgctcgccgacaccaccacctggttaacctgccccctgggagccccttgagcccgggg
tcagtgcgcacgccgctgagccgctcgcacaccctgagcgccggctgcggcaaccgcgcg
agcaaggtgacgctggcgccggcagggggcgccctgcaacacagccgctccatgtccatg
ccggtggcgcactcgccccccgcagccaccagcccgggcagcctgtcgtctagcagcggg
catggctcgggctcctacccnnnnnnnnnnnnnnnnnnnnnnnncctgccgcatcccctg
caccaccacgccggccagcggccctccagtggcagtgcctcagcctccggctcccccagc
gatcccggcttcatgtccctggatgagtacggctccagccctggggacctgagagccttc
tgcagccacaggagcaacacaccggagtccatcgcggagacgcctccggccagggatggg
agcgggagtgagctgtacgggtacatgaccatggacaggcccctgagccactgtggccgg
ccctaccgtcgagtgtcgggggactgcgcgcaggacttggacagagggctgagaaagagg
acttactccctgaccgcccccgcccggcagcggccggtgccccagccctcctctgcttcc
ctggatgagtacaccctgatgcgggccaccttctccggcagctccagccgcctctgcccg
tcctgccccacgtcttctcccaaagtggcctaccacccttatcctgaggactacggcgac
attgagattgggtcccaccggagctccagcagtaacctgggcacggacgatggttacatg
cccatgacccctggagtggccctcatgggtggtggcagcggcagctgcaagagtgacgac
tnggctggcagggcctttccggggaacggggccagctgcaaggccggctccccggccgaa
agctcgccggaggacagtggatacatgcgcatgtggtgtggctccaagctgcccgtggag
ggccccgacagtaagctgcttcccaacggggactacctcaacatgtcccccagcgacgcg
ggcacctcgggagccccgctggacttcttctcggcggccttgcatggcgggggggagatg
ctcaggagcgtccccggctactgctacagctccctgccccgctcctacaaggctccctac
acctgcaacggggacaatgaccagtacgtgctcatgagctcccccgtggggcgcattctg
gaagaggagaggccggcgcctccggccagcgtgggccccgcg

DBGET integrated database retrieval system