KEGG   Miniopterus natalensis: 107525530Help
Entry
107525530         CDS       T05883                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain
  KO
K06237  collagen, type IV, alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04512  ECM-receptor interaction
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04974  Protein digestion and absorption
mna05146  Amoebiasis
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107525530 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107525530 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107525530 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107525530 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    107525530 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525530 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107525530 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107525530 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107525530 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107525530 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107525530 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107525530 (COL4A4)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107525530 (COL4A4)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   107525530 (COL4A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 107525530
NCBI-ProteinID: XP_016053200
LinkDB All DBs
Position
Unknown
AA seq 1741 aa AA seqDB search
MALGASTLPSRSSGSGGYGVGKTGDPRNRKCDDDEGPGTERGAGHGRAGKSRCSSRPGSF
LRVDGARPAAAARGQDLNAPPADPPPRSVQSRQREQCPHGRGRAEPSSWNFCPRGHPGPP
GPQGPIGPLGPPGPTGIPGAKGMRGDSGPPGAAGDRGDKGPTGVPGFPGLDGIPGHPGPP
GFRGKPGKDGCNGSRGDPGFPGERGAPGLEGPPGLPGEKGEKGNSLFIFGGIKGIQGDRG
DPGPPGLPGSRGGRGPAGPMGYPGEPGLPGPWGHPGSPGVKGSPGVGVKGQMGDPGEVGQ
QGFPGPTLLIQPPDSCLLKGQKGVKGIPGMIGPPGPPGHKGEPGIGEKGEKGIPGFPGPR
GDPGSHGSPGFPGLKGEQGPFGAPGPFGFPGQKGDPGDRGYPGPPGVLTTPPLPFKGPPG
DPGLPGRSGEVGDVGLPGLPGPPGWPGEACPGMMGLPGPPGPPGHPGAPGAAGAPARPDS
APGKPGHPGPPGLPGAPGRQGPPGSDVIYCRVGHPGPQGVKGKMGPPGRRGSKGEKGNAG
LCACKPCPMGSPGPPGLPGRQGSKGDLGIPGWPGEKGHPGPPGAEGSPGPPGKPGPPGPP
GSKGEKGDMAVSRVKGRKGERGPDGPPGFPGQQGKHGWDGRAGARGDPGPPGDHEDAGPG
DRGFPGWPGPPGREGPGGPPGLGFPGPPGQRGQPGAPGRPGERGPHGAKGLKGDTISCNV
SYPGMPGPPGFDGPPGPKGFPGPQGPPGLKCFDGQKGQPGKPGISKIPGPPGLRGDMGDP
GSVGERGSSPAGPPGSPGAPGAGGQKGIPGDPAYGHPGPPGRRGLQGMPGLKGLRGDPGY
PGPAGPAGTPGLPGLKGPKGKEGSAGFPGVPGPPGHSCERGAPGLPGRPGLPGAPGSPGD
PGWKGQRGDAGPPGPAGMKGLPGVPGNPAPDGPPGPPGIPGPRGDDGLPGLPGPKGPQGL
PGLPGFPGERGKPGPEGLPGRKGEVGEKGWPGFLGDQGQSGGKGQRGRPGDAGEMAIISK
KGKTGEPGPPGDDGVPGEEGDKGHPGMPGRKGDPGRPGPPGIHRGEPGGRGLPGLPGPPG
PPGPPGHRGIIGFPGFPGDQGELGFPGPPGLSGIDGTRGPKGSKGDPASQFGPPGPKGEP
GSPGCPGHLGPPGDKGLPGAEGPRGPPGRPGAPGASGPPGCPGNQGKPGPMGHPGEMGDP
GPRGLMGYPGVPGLPGIKGPPGLPGLNGLHGLKGQKGAKGASGLSEMGPPGPMGMPGPKG
ETGDPGSPGISPPGLFGEKGPPGPPGRPGPPGPAGATGRTPKADTPDPGPPGDPGPPGPD
GPRGPPGPPGAPGSVDLLRGDPGDCGLPGPPGPPGLPGPPGRKGFPGCDGHDGPKGPVGF
PGPQGPHGFPGSPGEKGCPGPPGRKGPPGPPGYRGKPGPPADLDACPRIPGLPGVPGPRG
PEGAMGLPGMRGPPGAGCKGQPGLDGRRGEDGIPGPPGPPGHRGDMGEAGCPGAPGPPGP
IGDPGPKGFGPGYLSGFLLVLHSQTDGEPTCPMGMPRLWTGYSLLYLEGQERAHSQDLGL
AGSCLPVFSTLPFAYCNIHQVCHYARRNDRSYWLASAAPLPMSPLAGEDIRPYISRCAVC
EAPAQAVALHSQDQAIPPCPRAWRSLWIGYSFLMHTGAGDQGGGQALTSPGSCLEDFRAA
PFLECQGRLGTCHFFANKYSFWLTAVKPHLQFSAAPSPETLKDSQAQREKISRCQVCMKV
G
NT seq 5226 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggcgcttcgactctgccctccaggagctcggggtccggtgggtatggggtt
gggaagacaggtgatccccggaacagaaaatgtgatgatgatgaagggcccgggacggag
aggggagcaggtcacgggcgggcgggcaagagcaggtgctcctcgaggccaggctccttc
ctccgggtagacggagcgcggcctgcagctgctgctcgggggcaggacctgaacgcgccc
ccggcggacccgccgcctcgctcggtgcagagcaggcagagggagcaatgtccccacggc
aggggcagggcagagcccagctcgtggaacttctgcccccgaggtcacccaggaccacca
gggccacagggccctattggaccgctgggacctccaggacccactggaatcccaggagcg
aaagggatgagaggggacagtggccctcccggagcagcaggcgatagaggagataagggt
cccactggtgttcctggatttccaggtttggatggtatacctgggcacccagggcctcct
ggattcagaggcaaacctggcaaggatggctgcaatggctcaagaggtgatccagggttt
ccaggagaaagaggagctcctggtctcgaaggccccccaggccttcctggggaaaaagga
gagaaaggaaattcactgttcattttcggtggcattaaaggtattcagggtgacagagga
gacccaggacctcccggcttaccaggatcaaggggtggtagaggaccggcaggcccaatg
ggatacccaggagagccggggttaccgggaccttggggccatcctgggagcccgggtgtg
aagggcagtcctggcgtgggagtcaaggggcagatgggagacccgggcgaggttggccag
caaggttttcctgggccgaccctgctgatacagccaccggattcttgtctccttaaagga
caaaagggtgtaaaaggaatacctggaatgattggacctccgggacctccaggacacaag
ggagaacctggcattggggaaaagggagagaaaggcattcctggcttcccgggtccccgg
ggtgaccctggctcccatggatctccaggttttccgggattaaagggggaacaaggaccg
tttggagctcctgggccatttggatttcctggccagaagggagatcccggagaccgtggg
tacccaggaccaccaggggtgttgacaactccacctctcccattcaaaggccctccgggg
gacccgggcctgcctggccgctccggagaagtgggggatgtcggactccctggtctcccc
ggccccccaggttggccaggggaagcctgtccaggcatgatggggctccctgggccgcca
gggcctccgggccacccgggagctccaggggcagccggcgctcctgcgagacctgattcc
gctccaggaaaaccagggcacccgggaccgcccgggctgcctggagcaccaggacgtcag
ggacctccggggtcagatgttatatattgtagagttggacaccctgggccgcaaggagta
aaaggcaaaatgggtcctccgggaagaagaggctccaaaggagaaaaaggaaatgcgggg
ctctgtgcctgtaagccttgccccatgggctcaccgggccctccagggcttcctgggagg
cagggtagtaagggagacttggggattcctgggtggcctggagaaaaaggtcacccgggc
cctcctggtgctgaaggatctccagggccaccgggaaaacctggtcccccaggaccacct
ggcagcaaaggagaaaagggagacatggctgtatcaagagtgaaagggcgcaaaggagaa
agaggtcccgatgggcccccaggatttccagggcagcagggaaaacatggctgggatgga
cgtgctggagcaagaggggatccaggacccccaggggatcatgaagatgcaggcccaggt
gaccgaggatttcctggatggcccggacccccgggcagagaaggacctggggggcctcca
ggactgggatttcctggtccaccgggacaaagagggcaaccaggagccccaggccgccca
ggcgagaggggccctcatggcgcaaagggtctgaaaggtgatacaatatcttgtaacgtc
agctaccctgggatgccaggccctccgggttttgatggacctccaggtccaaagggattt
cccggtcctcagggtcctcctgggctcaagtgtttcgatgggcagaaaggtcagcctggc
aaaccaggaatatcaaaaatacctggtccacctggtcttcgtggtgacatgggagatcca
ggctctgtaggtgaaagaggctcctctcctgctgggcccccaggctctcccggtgcccct
ggagcaggtggtcagaagggaatccccggagaccctgcttatggccacccaggacccccg
ggaaggaggggccttcagggaatgccagggttgaaaggactcagaggcgacccaggatat
cctgggcctgcagggccagcgggcacgcccggattgccgggtctcaaaggtccgaaaggc
aaagagggaagtgctgggtttccaggtgtcccggggccacccggccattcctgcgaaaga
ggcgcccccggcttaccgggccgtccggggctccccggggctccaggcagcccaggtgac
cctggttggaaaggacagcgaggagatgcggggcctcctggaccagctggaatgaagggc
ctcccaggagtcccaggaaatccagcgccagatggacccccaggacccccaggaatccca
ggtccccgtggcgatgatggactgcctggtctgccaggtcccaagggaccccaggggctg
cctggcttgccgggttttcctggagagagaggaaagcctggccccgagggcctccctggc
agaaagggcgaagtcggagagaagggctggcctggcttcctgggcgaccagggacagagc
ggcggcaaaggacagagaggacgcccaggagatgcaggggaaatggcgataatctccaag
aaggggaaaaccggggagcccgggcctcctggcgacgatggagtccccggggaagaaggt
gacaaaggccatcctgggatgccgggcagaaaaggagatccaggaagacccgggccaccg
gggattcacagaggagagcccggtggacgtgggctgcctgggcttcccggccccccgggc
cctccaggcccacctggacacagggggatcattggtttcccgggatttccaggtgaccag
ggtgagctgggttttccagggccccccggcctttcaggaattgatggaacaagaggacct
aaaggaagcaaaggtgaccctgcaagtcagtttggcccacctggtccaaagggtgagcca
ggtagccctggatgtccagggcaccttggaccccccggggacaagggcttgcctggtgct
gaagggcccagaggaccaccggggaggccaggagcgcccggcgcctccggaccgccaggc
tgtccaggtaatcaagggaagcctgggcccatgggacatccaggagaaatgggggaccct
ggaccaagaggcctcatggggtacccaggggtaccaggtcttccgggaataaaaggtccc
cccgggttacccggcctgaatggcttgcatggcttaaaaggtcagaaaggagccaaagga
gcttcaggtttgagtgaaatgggcccacctggtccaatgggaatgcctgggccgaaaggg
gagaccggcgaccctgggagcccaggaatctctcctccaggcctctttggagaaaaaggc
cccccaggccctccagggagacctgggccacctggacctgcaggtgccactggaagaact
ccaaaggctgacactcctgacccgggtccacctggagatccaggaccccctggccctgat
ggtcccagaggaccgcctgggcctccaggggcccctgggagcgttgacctcctgcgaggg
gatccaggtgactgtggtctgccagggcctccaggccccccgggcctgccaggcccccca
ggacgcaaaggcttcccaggatgcgatggacacgatggcccgaaaggaccagtgggattc
ccggggccgcaggggccacacggatttcccgggtcacctggagagaagggctgcccaggc
cctcccggcagaaaaggccccccagggcctccaggttacagaggtaagccggggccacct
gcggatttggatgcctgcccccgaatcccagggcttcctggggtaccaggcccaagagga
ccagaaggagccatggggctccccgggatgagaggccctccaggagcagggtgcaaggga
cagcccgggctggacggcaggaggggtgaggatggcatcccagggccgcctgggcctccg
ggacacagaggtgacatgggagaagccggctgccctggagcaccaggccctcctgggccc
attggggatcctgggcccaaagggttcggccctggatacctcagcggcttcctcctggtt
ctccacagtcagacggacggagagcccacctgccccatgggcatgcccaggctctggacg
ggctacagtctgctctacctggaaggacaggagagggctcacagtcaggacctgggtctg
gcggggtcttgcctcccggtgttcagcacactgcccttcgcctactgcaacatccaccaa
gtctgccactacgcccggagaaacgacaggtcctactggctggccagcgccgcgcccctg
cccatgtcgccgctggccggggaggacatccgcccctacatcagccgctgcgccgtgtgc
gaggccccggcgcaggcggtggcgctgcacagccaggaccaggccatcccgccgtgtccg
cgcgcctggcgcagcctctggatcgggtactccttcctcatgcacacaggcgctggggac
caaggaggagggcaggcgctcacgtcacctggcagctgcctggaagatttccgagccgct
ccattcctcgaatgccaaggccggctgggaacgtgccacttctttgcaaacaagtacagc
ttctggctgacggcggtcaaaccacacttgcagttttccgcggcaccatcaccagaaacc
ttgaaggacagccaggcccagcgcgagaagatcagcaggtgccaggtctgcatgaaggtc
ggctag

DBGET integrated database retrieval system