KEGG   Miniopterus natalensis: 107525625
Entry
107525625         CDS       T05883                                 

Gene name
FZR1
Definition
(RefSeq) fizzy-related protein homolog isoform X1
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04120  Ubiquitin mediated proteolysis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107525625 (FZR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107525625 (FZR1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107525625 (FZR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107525625 (FZR1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     107525625 (FZR1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Nup160
Other DBs
NCBI-GeneID: 107525625
NCBI-ProteinID: XP_016053308
LinkDB
Position
Unknown
AA seq 496 aa
MDQDYERRLLRQIVIQNENTMPCVSEMRRTLTPTNSPVSSPSKHGDRFIPSRAGANWSVN
FHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
GNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNADQLSSGSRDRMILQRDIRT
PPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
VKWESVSVLNLFTRIR
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggaccaggactacgagcggcgcctccttcggcagattgtcatccagaacgagaatacg
atgccgtgtgtctcagagatgcggcggaccctgactcctaccaactcccccgtgtcctcc
cccagcaagcatggggaccgcttcatcccctcaagagccggtgccaactggagtgtcaat
ttccacaggatcaatgaaaatgagaagtctcccagccagaaccggaaagccaaggatgcc
acctcggacaatggcaaagatggcctggcctactcagccctgctgaagaatgaactgcta
ggggccggcatcgagaaggtgcaggacccgcagacagaggaccgcaggctgcagccttcc
acgcctgagaagaagggcctgttcacgtattccctcagtaccaagcgctcaagccctgat
gacggcaatgacgtgtctccctactccttgtcaccagtcagcaacaaaagtcagaagtta
ttgcggtcaccacggaaacctacccgcaagatctctaagatccccttcaaggttctggac
gcacccgagttgcaggacgacttctacctgaacctggtggactggtcatctctcaatgtg
ctcagtgtggggctgggcacctgtgtatacctgtggagtgcctgcaccagccaggtgacc
cggctctgtgacctctctgtggaaggggactcggtgacctccgtgggctggtctgagcgg
gggaacctggtggctgtcggcacgcacaaaggctttgtgcagatctgggatgcagctgcg
ggaaagaagctctccatgctggaaggccacacagcacgtgttggggcgctggcctggaat
gccgaccagctctcgtctgggagccgggatcgcatgatcctgcaaagggacatacgtacc
ccgcccttgcagtcagagcggcggctgcagggccaccgacaggaggtgtgcgggctcaag
tggtccaccgaccaccagcttctcgcctcaggaggcaacgacaacaagctgctggtctgg
aaccactcgagcctgagtcctgtgcagcagtatacagagcacctggcggccgtgaaggcc
atagcctggtccccacaccagcatgggctgctggcatccggcggtggcacagccgaccgc
tgcatccgcttctggaacacactcacagggcagccgctgcagtgcatcgacacaggctcc
caggtgtgcaacctggcttggtccaagcacgccaacgagctggttagcacgcatggctac
tcacaaaaccagatcctggtctggaagtacccatccctgacccaggtggccaagttgact
gggcactcctaccgagttctgtacctggccatgtcccctgatggagaggccattgtcact
ggtgctggagacgaaaccctgaggttctggaatgtcttcagcaaaacccgttcaacaaag
gtaaagtgggaatctgtgtctgtcctcaacctcttcaccaggattcggtaa

DBGET integrated database retrieval system