KEGG   Miniopterus natalensis: 107525782
Entry
107525782         CDS       T05883                                 

Gene name
HPRT1
Definition
(RefSeq) hypoxanthine-guanine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107525782 (HPRT1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107525782 (HPRT1)
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     107525782 (HPRT1)
SSDB
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Other DBs
NCBI-GeneID: 107525782
NCBI-ProteinID: XP_016053503
LinkDB
Position
Unknown
AA seq 317 aa
MPMDMTWVTHLNRSQLPGHVRRLKRCVVGYSRQFCFCFLAKLLIYNLNYSPLKHSVDFWY
NFNTRKLLKVLDIWYLNFSDRLKFLTYKSNQVFIPCNALIKTAIFLFQISDDEPGYDLDL
FCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDY
IKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGK
TMQTLLSLVKQHNPKMVKVASLLVKRTPRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRD
LNHVCVISETGKAKYKA
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcccatggacatgacctgggttacccacctgaatcgcagccagcttcctggccatgtg
cgcagactgaagcggtgtgtagttggctattctaggcagttttgtttttgttttttagca
aagttgttaatctacaatcttaactattcacctttaaaacatagtgttgatttctggtat
aactttaataccagaaagttactgaaagttcttgatatctggtatctaaatttctctgat
cggctaaagtttttaacatataaatccaatcaagtgtttataccctgtaatgctctcatt
aaaacagccatatttctttttcagattagtgatgatgaaccaggttatgacctagattta
ttttgtatacctaatcattacgctgaggatttggaaaaggtgtttattcctcatggactc
attatggacaggactgaacgtcttgctcgagacgtgatgaaggagatgggaggccatcac
attgtagccctctgtgttctcaaggggggctataaattctttgctgacctgctggattac
atcaaagcactgaacagaaatagtgatagatccattcctatgactgtagattttatcaga
ctgaagagctactgtaatgaccaatcaactggggacatcaaagtaattggtggagatgat
ctctcaactttaactggaaagaatgtcttgattgttgaagatataattgacactggcaaa
acaatgcaaaccttgctttccttggtcaagcagcataatccgaagatggtcaaggttgca
agcttactggtaaaaaggacccctcgaagcgttggatatagaccagactttgttggattt
gaaattccagacaagtttgttgtaggatatgcccttgactataatgaatacttcagggat
ttgaatcatgtttgtgttattagtgaaactggaaaagcaaaatacaaagcctaa

KEGG   Miniopterus natalensis: 107536689
Entry
107536689         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: hypoxanthine-guanine phosphoribosyltransferase-like
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107536689
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107536689
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     107536689
SSDB
Motif
Pfam: Pribosyltran
Other DBs
NCBI-GeneID: 107536689
NCBI-ProteinID: XP_016067993
LinkDB
Position
Unknown
AA seq 247 aa
MLGHKYVGFIPRMQGDSQAALRPSLAQGVRATRRASVVISGDEPGYDLDLFCIPTHYAED
LEKVFMPHYGRTERLAGDVLKEMGGQPIAALXXXGGGLXILCHLLDCIKALNRYSDRSIP
MTVDFIRLKSYCNDQSTGDIKVIGGDDLSALTGKNVLIVEVTGKTMQTLLSWVKQHNPKM
VKVTSLLVKIRTPQSAGYRTDFVGFEIPDKIRLTDFVVGYALDYNEYFRDLSHVCVISDT
GKAKFQA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgttaggacacaaatacgtgggatttattcctcgaatgcaaggagactctcaggctgcc
ctgcgcccctcgctggcccagggcgttagggcgactcgcagggccagcgtggtgataagt
ggtgatgaaccaggttatgacctagatttattttgtatacctactcattacgctgaggat
ttggaaaaggtgtttatgcctcattatggaaggacagaacgccttgctggagatgtgctg
aaggagatgggtggccagcccattgcagccctnnnnnnnnnngggggagggctataaatt
ctttgtcacctgctggattgcatcaaagcgctgaacaggtatagtgatagatccattcct
atgactgtagattttatcagactgaagagctactgtaatgaccaatcaacaggggacatc
aaagtaattggtggagatgatctctcagctttaactggaaagaatgtcttgattgtggaa
gttactggcaaaacaatgcaaaccttgctttcctgggtcaagcagcataatccgaagatg
gtcaaggtcacaagcttgctggtaaaaattaggacccctcaaagtgctggatatagaaca
gactttgttggatttgaaattccagacaagatcagactgacagattttgttgtaggatat
gcccttgactataatgaatacttcagggatttgagccatgtttgtgtgattagtgacact
ggaaaagcaaaattccaagcctaa

DBGET integrated database retrieval system