KEGG   Miniopterus natalensis: 107525813
Entry
107525813         CDS       T05883                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04218  Cellular senescence
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04940  Type I diabetes mellitus
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05203  Viral carcinogenesis
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107525813
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107525813
   04145 Phagosome
    107525813
  09143 Cell growth and death
   04218 Cellular senescence
    107525813
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107525813
   04612 Antigen processing and presentation
    107525813
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107525813
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107525813
   05170 Human immunodeficiency virus 1 infection
    107525813
   05168 Herpes simplex virus 1 infection
    107525813
   05163 Human cytomegalovirus infection
    107525813
   05167 Kaposi sarcoma-associated herpesvirus infection
    107525813
   05169 Epstein-Barr virus infection
    107525813
   05165 Human papillomavirus infection
    107525813
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107525813
   05330 Allograft rejection
    107525813
   05332 Graft-versus-host disease
    107525813
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107525813
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107525813
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107525813
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107525813
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107525813
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Antigens
  107525813
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 C2-set_2 LapA_dom PTCRA Psg1
Other DBs
NCBI-GeneID: 107525813
NCBI-ProteinID: XP_016053527
LinkDB
Position
Unknown
AA seq 358 aa
MRPPTLLLLLWPTLVRTQPGAGSHSLVYFHTAVSRPGRGEPRYLEVGYVDDTQFERFDSD
SRSQRAEPRAGWMELVELEEPGYWELSTRNARASARASRVNLQTFIDYYNQSRDGSHTFQ
AMWGCEMGPDGRLLLGYFQQAYDGTDYIALNDDLRSWTSADRAAQITQRKWEAAGEADAI
RSRLQGLCLQMLQRFLEMGKETLQRADPPKTHVTHHPISDNKVILKCWALGFYPAEITLT
WLRDGEDQSQDMEVVETRPAGDGTFQKWAAVAVPAGEEQSYTCHVRHEGLPEPVTLSWEP
APQATIPNVVIIVVLFFLGAVICGTVAAAAVMFRRKRSGGKREIYALAATLGVCLVRD
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaggcccccaaccctcctcttgctgctctggccgaccctggttaggacccagcccggg
gcgggctcccactccctggtctacttccacaccgccgtgtcccggccgggccgcggggag
ccccggtacctcgaagtcggctacgtggacgacacccagttcgagcggttcgacagcgac
tccaggagccagagggcggagccgcgggcggggtggatggagctggtggagctggaggag
cccggctactgggagctgagcacccggaacgcgcgggcctcggcgcgggcgtcccgcgtg
aacctgcagacgttcatcgactactacaaccagagccgcgacgggtctcataccttccag
gccatgtggggctgtgaaatgggaccggatgggcgcctccttcttggctatttccaacaa
gcctacgacggcaccgactacatcgcgctgaacgatgacctgcgctcctggacctccgcc
gaccgggcggcgcagatcacccagcgcaagtgggaggcggcgggcgaggctgatgccatc
aggagccgactgcagggcttgtgcctgcagatgctccagagattcctggaaatggggaag
gagactctgcagcgcgcggacccgccaaagacacatgtgacccaccaccccatctctgac
aataaggtcatcctgaagtgctgggccctcggcttctaccctgcggagatcaccttgacc
tggctgcgtgatggggaggaccagtcccaggacatggaggttgtggagaccaggcctgca
ggggatgggaccttccagaagtgggcggctgtggcagtgcccgctggagaggagcagagt
tacacctgccatgtgcggcacgaggggctgcccgagcctgtgaccctgagttgggagcca
gctcctcaggccaccatccccaatgtggtcatcattgttgtcctgttcttccttggggct
gtgatctgtggaactgtggctgctgcagctgtgatgttcaggaggaagcgctcaggtgga
aaaagagagatttatgcactggctgccacgttaggcgtgtgccttgtgagggactga

KEGG   Miniopterus natalensis: 107528441
Entry
107528441         CDS       T05883                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04218  Cellular senescence
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04940  Type I diabetes mellitus
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05203  Viral carcinogenesis
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107528441
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107528441
   04145 Phagosome
    107528441
  09143 Cell growth and death
   04218 Cellular senescence
    107528441
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107528441
   04612 Antigen processing and presentation
    107528441
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107528441
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107528441
   05170 Human immunodeficiency virus 1 infection
    107528441
   05168 Herpes simplex virus 1 infection
    107528441
   05163 Human cytomegalovirus infection
    107528441
   05167 Kaposi sarcoma-associated herpesvirus infection
    107528441
   05169 Epstein-Barr virus infection
    107528441
   05165 Human papillomavirus infection
    107528441
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107528441
   05330 Allograft rejection
    107528441
   05332 Graft-versus-host disease
    107528441
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107528441
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107528441
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107528441
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107528441
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107528441
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Antigens
  107528441
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig Ig_3
Other DBs
NCBI-GeneID: 107528441
NCBI-ProteinID: XP_016057010
LinkDB
Position
Unknown
AA seq 388 aa
MYRIFMPGDSRFPFPFLPAESPWGLPVVADGPASLAKDVMAELASLKLEKKPWPGGSHSL
RYHYLALSEPGPGLPHFLAVGYVDDHPFIRYDSRVGRAEPQAPWIAPLDAQYWETETQKQ
RAWAEVQQVEMWTVMGYYNQSGGRHSAQRMFGCNMQEDGRSSSFWQFGFDGQDHLSLDLE
TLSWVSAEPMAVRTKRWWESERCYAEYDKAYLEGLCLASLRRYLELGGPSLTRREPPTVQ
VTRHVIQGRGVTLRCWALGFYPQDISLSWWLGEEELTLETEYVETRPSGDGTYQTWAAVW
VPAGEEAGYTCHVQHAGLNHMLTVAWEPPSSQGFIAMVICPILFLLVVGAVILTRRYLQA
KDEEPYEQAPGDYGLGGFWRGSPRCSQA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtacaggatatttatgcctggagattcacgcttcccttttccatttctccctgcagag
agtccctgggggctgcctgtggtggccgatggcccggcttccttagcaaaggacgtgatg
gcggaactggccagtctgaagctggaaaagaagccatggcctggagggtcgcactccctc
cgctaccactacctggccctgtcagagccaggccccggcctcccccactttctggctgtg
ggctacgtggacgaccaccccttcatacggtacgacagtcgtgtgggcagggccgagccc
caggccccatggatcgcgcccctggacgcccagtactgggagacagagacccagaagcag
agggcctgggcagaggtgcagcaggtggagatgtggacggtgatgggctactacaaccag
agtggcggccggcacagcgctcagcgcatgttcggctgtaacatgcaggaggacggccgc
tccagcagcttctggcagttcggctttgatgggcaggatcacctgtcgctggacctggag
actctgagctgggtgtcagctgagcccatggccgtgcggaccaagcgctggtgggagtcg
gagcgctgctacgctgagtacgacaaggcctacctggaaggcctctgcctcgcctccctg
cgcaggtacctggagctcggaggcccaagcctcacccggagagagccgcccacagtgcag
gtgacgaggcacgtgatccagggcaggggcgtcacactgaggtgctgggccctgggcttc
tacccacaggacatctcactgagctggtggctgggtgaggaggaactgaccctggagacc
gagtacgtggagacacgccccagcggggacggcacctaccagacttgggccgctgtgtgg
gtgccggctggggaggaggctggctacacctgccacgtgcagcacgctggcctgaaccac
atgctcaccgtggcgtgggaaccgccctccagtcaaggattcattgccatggttatctgc
cccatcctgttcttgctggtggttggagctgtgatcctgaccaggaggtaccttcaagcc
aaggatgaggaaccttatgaacaagccccaggtgattatgggctgggtgggttctggaga
ggaagccccaggtgctcccaagcctga

KEGG   Miniopterus natalensis: 107538488
Entry
107538488         CDS       T05883                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-2 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04218  Cellular senescence
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04940  Type I diabetes mellitus
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05203  Viral carcinogenesis
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107538488
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107538488
   04145 Phagosome
    107538488
  09143 Cell growth and death
   04218 Cellular senescence
    107538488
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107538488
   04612 Antigen processing and presentation
    107538488
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107538488
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107538488
   05170 Human immunodeficiency virus 1 infection
    107538488
   05168 Herpes simplex virus 1 infection
    107538488
   05163 Human cytomegalovirus infection
    107538488
   05167 Kaposi sarcoma-associated herpesvirus infection
    107538488
   05169 Epstein-Barr virus infection
    107538488
   05165 Human papillomavirus infection
    107538488
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107538488
   05330 Allograft rejection
    107538488
   05332 Graft-versus-host disease
    107538488
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107538488
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107538488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538488
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107538488
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107538488
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Antigens
  107538488
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2 ig MATalpha_HMGbox
Other DBs
NCBI-GeneID: 107538488
NCBI-ProteinID: XP_016070237
LinkDB
Position
Unknown
AA seq 204 aa
DYISLNEDLRSWTAADTAAQISRRKYESVDEAEVRRNYLGTECMEWLRRYLDEGKATLQR
ADPPETHVTHHPISDREVSLRCWALGFYPAEITLTWHRDGEEQTQDTELVETRPAGDGTF
QKWAAVVVPPGEEQRYTCHVQHEGLPEPRTLRWEPPLQPTFIAVLVFGAVVTGAVAAGTL
AAGAVMWGKKGTAAKGWSYAQAAM
NT seq 615 nt   +upstreamnt  +downstreamnt
gactacatctccctgaacgaggacctgcgctcctggaccgcggccgacacggcggctcag
atctcccggcgcaagtacgagtctgtggacgaggcggaggtccggaggaactacctgggg
acggagtgcatggagtggctccgcagatacctggacgaagggaaggcgacgctgcagcgc
gcagatcccccagagacacatgtgacccatcaccccatctctgaccgtgaggtcagcctg
aggtgctgggccctgggcttctaccctgcggagatcaccctcacctggcaccgcgatggg
gaggagcagacccaggacacggagcttgtggagaccaggcctgcgggggacgggactttc
cagaagtgggcggccgtggtggtgccccctggagaggagcagagatacacgtgccatgtg
cagcacgaggggctgcccgagccccgcacactgagatgggagccacctcttcagcccacc
ttcattgctgtccttgtttttggagctgtggtcactggagctgtggcagctggaactctg
gcagctggagctgtgatgtgggggaagaagggtacagctgcaaaaggatggagctacgct
caggctgccatgtga

KEGG   Miniopterus natalensis: 107538961
Entry
107538961         CDS       T05883                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04218  Cellular senescence
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04940  Type I diabetes mellitus
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05203  Viral carcinogenesis
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107538961
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107538961
   04145 Phagosome
    107538961
  09143 Cell growth and death
   04218 Cellular senescence
    107538961
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107538961
   04612 Antigen processing and presentation
    107538961
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107538961
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107538961
   05170 Human immunodeficiency virus 1 infection
    107538961
   05168 Herpes simplex virus 1 infection
    107538961
   05163 Human cytomegalovirus infection
    107538961
   05167 Kaposi sarcoma-associated herpesvirus infection
    107538961
   05169 Epstein-Barr virus infection
    107538961
   05165 Human papillomavirus infection
    107538961
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107538961
   05330 Allograft rejection
    107538961
   05332 Graft-versus-host disease
    107538961
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107538961
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107538961
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538961
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107538961
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107538961
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Antigens
  107538961
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 107538961
NCBI-ProteinID: XP_016070800
LinkDB
Position
Unknown
AA seq 337 aa
MSGPHSLRYFHTAVSRPGRREALYISVGYVDDTQFLRFDSDAASPRVEPRAPWMEQEAQP
FWEAQTEIAQVHAQISRVNLQTALGYYNQSESGSHTFQWTSGCDVGPDGRFLRGYEQFAY
DGADYIALSEDLRSWTAAAPAAQLTRRKWEAAGLAERYRAYLERECVELLRRYLENGRET
LQRADPPETHVTHHPISDREVSLRCWALGFYPAEITLTWHRDGEEQTQDTELVETRPAGD
GTFQKWAAVVVPPGEEQRYTCHVQHEGLPEPRTLRWEPPLQPTFIAVLVFGAVVTGAVAA
GTLAAGAVMWGKKGTGAKGRSYTQAASSDVSLRAPEV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgtcagggccccactccctgagatatttccacaccgccgtgtcccgccccggccgccgg
gaggccctctacatctccgtcggctacgtggacgacacgcagttcctgcggttcgacagc
gacgccgcgagccccagggtggagccgcgggcgccgtggatggagcaggaagcgcagccc
ttctgggaagctcagaccgagatcgcccaggtccacgcgcagatttcccgcgtgaacctg
cagacggccctcggctactacaaccagagcgagtccgggtctcacaccttccagtggacg
tccggctgcgacgtggggcccgacgggcgcttcctccgcgggtacgagcagttcgcctac
gacggcgccgactacatcgcgctgagcgaggacctgcgctcctggaccgcggcggccccg
gcggcccagctcacccggcgcaagtgggaggcggcggggctggccgagcggtaccgggcg
tacctggagagggagtgcgtggagctgctgcgccgctacctggagaacgggagggagacg
ctgcagcgcgcagatcccccagagacacatgtgacccatcaccccatctctgaccgtgag
gtcagcctgaggtgctgggccctgggcttctaccctgcggagatcaccctcacctggcac
cgcgatggggaggagcagacccaggacacggagcttgtggagaccaggcctgcgggggac
gggactttccagaagtgggcggccgtggtggtgccccctggagaggagcagagatacacg
tgccatgtgcagcacgaggggctgcccgagccccgcacactgagatgggagccacctctt
cagcccaccttcattgctgtccttgtttttggagctgtggtcactggagctgtggcagct
ggaactctggcagctggagctgtgatgtgggggaagaagggtacaggtgcaaaaggacgg
agctacactcaggctgccagcagtgatgtgtctctcagggctcctgaagtgtga

KEGG   Miniopterus natalensis: 107546126
Entry
107546126         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: BOLA class I histocompatibility antigen, alpha chain BL3-6-like
  KO
K06751  MHC class I antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04218  Cellular senescence
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04940  Type I diabetes mellitus
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05203  Viral carcinogenesis
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107546126
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107546126
   04145 Phagosome
    107546126
  09143 Cell growth and death
   04218 Cellular senescence
    107546126
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107546126
   04612 Antigen processing and presentation
    107546126
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107546126
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107546126
   05170 Human immunodeficiency virus 1 infection
    107546126
   05168 Herpes simplex virus 1 infection
    107546126
   05163 Human cytomegalovirus infection
    107546126
   05167 Kaposi sarcoma-associated herpesvirus infection
    107546126
   05169 Epstein-Barr virus infection
    107546126
   05165 Human papillomavirus infection
    107546126
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107546126
   05330 Allograft rejection
    107546126
   05332 Graft-versus-host disease
    107546126
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107546126
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107546126
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107546126
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107546126
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107546126
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Antigens
  107546126
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 Ig_2 DUF6338 ig
Other DBs
NCBI-GeneID: 107546126
NCBI-ProteinID: XP_016079889
LinkDB
Position
Unknown
AA seq 388 aa
MGSPPLLLLLAGALVLTRTRAGPHSLRYFLTTLSRPGRGEPRYLEVGYVDDTQFVRFDSD
AANPRMEPRAPWMEQPWVEQEDAGYWDRNTRISKENAETDRVNLKTALGYYNQSEDGEPR
DPAPSPPPSPWTGRVAPSVGIRASPRGCGTALPPTRDLRSWTAADTAAQITRSKWEAAGE
AERVRNYLEGRCVDSLRRYLEKGKETLLRTDPPKTHVTRHPISEHEVTLRCWALGFYPAD
ISLTWQRDGQDQTQDMEFVETRPSGDGTFQKWASLGVPPGEEQRYTCVVQHEGLLGPQSL
RWEPPSQTPFIIMGAVVGLVVLGAVVAGAVMWARRRSGGEXGGVSFVSPWGVIPGRRVSC
FIHGKHRPQAWDCQCEVCVLTSCLVRQV
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggggtccccgcccctcctcctgctgctcgcgggggccctggtcctgacccgcacccgg
gccggcccccactccctgagatatttcctcaccaccttgtcccggcccggccgcggggag
ccccggtacctggaagtcggctacgtggacgacacgcagttcgtgcggttcgacagcgac
gccgcgaatccgaggatggagccgcgggcgccgtggatggagcagccgtgggtggagcag
gaggacgcggggtattgggaccggaacacgcggatcagcaaggaaaatgcagagactgac
cgagtgaacctgaagaccgccctcggctactacaaccagagcgaggacggtgagccccgc
gacccggccccgtcaccacccccatccccatggaccggccgggtcgccccgagtgtcggg
atccgagcttcaccccgaggctgcggaaccgccctgccccccacccgggacctgcgctcc
tggaccgcggccgacacggcggctcagatcacccggagcaagtgggaggcggccggtgag
gcggagagagtcaggaactacctggagggccggtgcgtggactcgctgcgccgttacctg
gagaaggggaaggagaccctgctgcgcacagaccctccaaagacacacgtgacccgccac
cccatctctgagcatgaggtcaccctgaggtgctgggccctgggcttctaccctgcggac
atcagcctgacctggcagcgagacgggcaggaccagacccaggacatggagtttgtggag
accaggccctcgggggacgggaccttccagaagtgggcgtccctgggggtgccccctgga
gaggagcagagatacacctgtgttgtgcagcacgaggggctgctggggccccagagcctg
agatgggagcctccctctcagacccccttcatcatcatgggcgctgttgttggcctggtt
gtcctcggagctgtggtggctggagctgtgatgtgggcgaggaggcgctcaggtggggaa
ncggggggtgtgagtttcgtgtccccctggggtgtcatcccagggagacgtgtgtcctgc
ttcattcatgggaagcaccgtccccaggcctgggattgccagtgtgaggtctgtgtgctg
acttcctgtttagtgaggcaggtgtga

KEGG   Miniopterus natalensis: 107546127
Entry
107546127         CDS       T05883                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-C*0101/C*0102 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04145  Phagosome
mna04218  Cellular senescence
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04940  Type I diabetes mellitus
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05203  Viral carcinogenesis
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107546127
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107546127
   04145 Phagosome
    107546127
  09143 Cell growth and death
   04218 Cellular senescence
    107546127
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107546127
   04612 Antigen processing and presentation
    107546127
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107546127
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107546127
   05170 Human immunodeficiency virus 1 infection
    107546127
   05168 Herpes simplex virus 1 infection
    107546127
   05163 Human cytomegalovirus infection
    107546127
   05167 Kaposi sarcoma-associated herpesvirus infection
    107546127
   05169 Epstein-Barr virus infection
    107546127
   05165 Human papillomavirus infection
    107546127
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107546127
   05330 Allograft rejection
    107546127
   05332 Graft-versus-host disease
    107546127
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107546127
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107546127
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107546127
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107546127
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107546127
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Antigens
  107546127
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2 ig MATalpha_HMGbox
Other DBs
NCBI-GeneID: 107546127
NCBI-ProteinID: XP_016079891
LinkDB
Position
Unknown
AA seq 276 aa
MEPRSPWMEQEMPGYWDRETRRNKENAQIYRVNLKTLRGYYNQSEDGSHTIQRMYGCDLG
PDGRLLRGYDQHAYDGADYLALNEDLRSWTAADTAAQISRRKWEADGYAERQRNYLEGRC
VEWLRRYLEKGKETLLRTDPPKTHVTRHPISEHEVTLRCWALGFYPADISLTWQRDGQDQ
TQDMEFVETRPSGDGTFQKWASLGVPPGEEQRYTCVVQHEGLLGPQSLRWEPPSQTPFII
MGAVVGLVVLGAVVAGAVVAGAVMWARRRSGGEGGV
NT seq 831 nt   +upstreamnt  +downstreamnt
atggagccgcggtcgccgtggatggagcaggagatgccggggtattgggaccgtgagacg
cggaggaacaaggaaaatgcacagatttacagagtgaacctgaagaccctgcgcggctac
tacaaccagagcgaggacgggtctcacaccatccagaggatgtacggctgtgacctggga
ccggacgggcgcctcctccgcgggtatgatcagcacgcctacgacggcgccgactacctc
gccctgaacgaggacctgcgctcctggaccgcggccgacaccgcggctcagatctcccgg
cgcaagtgggaggcggacggttatgcggagagacagaggaactacctggagggccggtgc
gtggagtggctgcgccgttacctggagaaggggaaggagaccctgctgcgcacagaccct
ccaaagacacacgtgacccgccaccccatctctgagcatgaggtcaccctgaggtgctgg
gccctgggcttctaccctgcggacatcagcctgacctggcagcgagacgggcaggaccag
acccaggacatggagtttgtggagaccaggccctcgggggacgggaccttccagaagtgg
gcgtccctgggggtgccccctggagaggagcagagatacacctgtgttgtgcagcacgag
gggctgctggggccccagagcctgagatgggagcctccctctcagacccccttcatcatc
atgggcgctgttgttggcctggttgtcctcggagctgtggtggctggagctgtggtggct
ggagctgtgatgtgggcgaggaggcgctcaggtggggaagggggggtgtga

DBGET integrated database retrieval system