KEGG   Miniopterus natalensis: 107525835
Entry
107525835         CDS       T05883                                 

Gene name
MAP2K5
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 5 isoform X1
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04540  Gap junction
mna04722  Neurotrophin signaling pathway
mna04921  Oxytocin signaling pathway
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107525835 (MAP2K5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107525835 (MAP2K5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107525835 (MAP2K5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107525835 (MAP2K5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107525835 (MAP2K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107525835 (MAP2K5)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107525835 (MAP2K5)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE7 family
   107525835 (MAP2K5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 107525835
NCBI-ProteinID: XP_016053554
LinkDB
Position
Unknown
AA seq 448 aa
MLWLAFGPLPAMENQVLVIRIKIPNRGAVDWTVNSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAGSDALPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIM
QFNDGNATVVSMWVCRALEERRSQQGPP
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctgtggctggcctttggccccttgcctgccatggagaaccaggtgctggtgattcgc
atcaagattccaaataggggcgccgtggactggacggtgaactccggcccgcagctgctc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaaccacagcattt
gaatatgaagatgaagatggtgatcgaattacagtgagaagtgatgaagaaatgaaggca
atgctgtcatattactattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctacagatctttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacccgggccggaccctctcaacacagtagcccagcaggctcagatgcactt
ccaagcaatagcttaaagaagtcttctgctgaactgaaaaaaatattagccaatggtcag
atgaatgaacaagacatacggtatcgagacactcttggtcatggcaacggaggcacagtc
tacaaagcatatcacgtcccaagtgggaaaatcctagctgtaaaggtcatactactagat
attacactggaacttcaaaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcgtatatcataggattttatggtgcattttttgtagaaaacaggatttctatatgt
acagaattcatggatggaggatctttggatgtatatagaaaaattccagagcatgttctt
ggaaggattgcagtagcagttgttaaaggccttacctatctgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacaccagagggcaggtcaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcacctgaaagaatttcaggggagcagtatggaatccattctgatgtctgg
agcttaggaatctcattcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccggttggagagttctccgagccatttgtacatttcatcactcagtgcatg
cgaaaacagccaaaagaaaggccggcacctgaggaattgatgggccacccgttcatcatg
cagttcaacgatggaaacgccaccgtggtgtccatgtgggtgtgcagggcactggaggag
aggcggagccagcaggggcccccctga

DBGET integrated database retrieval system