KEGG   Miniopterus natalensis: 107525851
Entry
107525851         CDS       T05883                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04068  FoxO signaling pathway
mna04072  Phospholipase D signaling pathway
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04714  Thermogenesis
mna04722  Neurotrophin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05034  Alcoholism
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107525851 (SOS2)
   04012 ErbB signaling pathway
    107525851 (SOS2)
   04014 Ras signaling pathway
    107525851 (SOS2)
   04630 JAK-STAT signaling pathway
    107525851 (SOS2)
   04068 FoxO signaling pathway
    107525851 (SOS2)
   04072 Phospholipase D signaling pathway
    107525851 (SOS2)
   04151 PI3K-Akt signaling pathway
    107525851 (SOS2)
   04150 mTOR signaling pathway
    107525851 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107525851 (SOS2)
   04540 Gap junction
    107525851 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107525851 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107525851 (SOS2)
   04660 T cell receptor signaling pathway
    107525851 (SOS2)
   04662 B cell receptor signaling pathway
    107525851 (SOS2)
   04664 Fc epsilon RI signaling pathway
    107525851 (SOS2)
   04062 Chemokine signaling pathway
    107525851 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107525851 (SOS2)
   04912 GnRH signaling pathway
    107525851 (SOS2)
   04915 Estrogen signaling pathway
    107525851 (SOS2)
   04917 Prolactin signaling pathway
    107525851 (SOS2)
   04926 Relaxin signaling pathway
    107525851 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    107525851 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107525851 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107525851 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525851 (SOS2)
   05206 MicroRNAs in cancer
    107525851 (SOS2)
   05205 Proteoglycans in cancer
    107525851 (SOS2)
   05231 Choline metabolism in cancer
    107525851 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107525851 (SOS2)
   05225 Hepatocellular carcinoma
    107525851 (SOS2)
   05226 Gastric cancer
    107525851 (SOS2)
   05214 Glioma
    107525851 (SOS2)
   05221 Acute myeloid leukemia
    107525851 (SOS2)
   05220 Chronic myeloid leukemia
    107525851 (SOS2)
   05211 Renal cell carcinoma
    107525851 (SOS2)
   05215 Prostate cancer
    107525851 (SOS2)
   05213 Endometrial cancer
    107525851 (SOS2)
   05224 Breast cancer
    107525851 (SOS2)
   05223 Non-small cell lung cancer
    107525851 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    107525851 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107525851 (SOS2)
   05160 Hepatitis C
    107525851 (SOS2)
   05163 Human cytomegalovirus infection
    107525851 (SOS2)
   05165 Human papillomavirus infection
    107525851 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107525851 (SOS2)
   01522 Endocrine resistance
    107525851 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107525851 (SOS2)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107525851 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_19 PH_13 PH_10 PH_9
Other DBs
NCBI-GeneID: 107525851
NCBI-ProteinID: XP_016053574
LinkDB
Position
Unknown
AA seq 1272 aa
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVYNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDKKLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPAFNDHFSKLMARPAVALHFQSIADGFREAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSLDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDSLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
AEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLEFFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKAFFSSCGSLHKLS
EELLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPL
PSPPPPPPRDPLPDTPPPVPFRPPEHFINCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRIPRRCCVLSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3819 nt   +upstreamnt  +downstreamnt
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcccctcttactgcctgtggacaaaatccatccttcactgaaggaagttttagggtac
aaagtggactaccatgtgtccttatatattgtggctgtactagagtatatctcagctgat
attttgaaattggctggtaattatgtttataatattcgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctctgtgaagatgaacctagctcctcaggtgaattaaactactac
gatcttgtcagaactgaaattgcagaagaaagacagtatctgcgggaactaaatatgatc
ataaaagtgtttcgagaagcctttctttccgacaaaaagctgttcaaaccttctgacatt
gaaaagattttcagtaacatattagatatacatgagttgacagtaaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcccttagctggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctttcaccagcctttaatgatcatttcagtaagttgatggccagaccagcagtggctcta
cactttcagtccattgctgatggtttcagagaggcagttcgttatgtccttccacgcctt
atgctggtgcccgtgtatcactgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagaacaagaagacagagaatgtttgaaccaagcgattactgctctcatgaat
ctccaaggtagtttggaccgaatttacaagcagtattcacctcgacgccgacctggggat
cctgtttgccctttttacaatcgtcaattaagaagcaaacacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaatttattatggaaggtccattgacaagaattggtgctaagcatgaacggcatattttt
ctctttgatggcttaatgattagctgcaaacccaatcatagccagtcacgccttccaggt
tacagtagtgcagaatacagattaaaagaaaagtttgtcatgagaaaaatacaaatatgt
gataaagaagacacttgtgagtacaaacatgcttttgaattagtatccaaagatgaaaac
agcataatatttgctgctaagtcggctgaagagaaaaataattggatggcagcacttatt
tctcttcattatcgtagtactctagatcgaatgctagattcagtattgttgaaagaagaa
aatgaacaaccactgagattaccaagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacagcttgcaaagtagaagtggaatccccattattaaa
ggaggaacggttgtgaagttaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
gcagaaaaaggcgaacaaccaattagtgcagaccttaaaagatttcgcaaggaatacgtc
caaccagtacaacttaggattttaaatgtatttcggcactgggttgaacaccatttttat
gactttgaaagagatttggagttgcttgaaagactagaattcttcatttcaagtgtaaga
gggaaagccatgaagaaatgggtagagtcaattgctaagatcatcaagaggaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccgggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacacttttggaatctgatctctacaggaaagttcaaccttct
gaacttgtagggagtgtgtggaccaaagaagacaaagaaataaattctccgaatttatta
aaaatgattcgccatactacaaatcttacgctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcagtgctaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatagtcagtgcagtaaattcagtgtca
gtatacagactagatcatacctttgaggccttgcaggaaagaaaaaggagaattttggat
gaagctgtggaattaagtcaagatcactttaaaaaatacctagtaaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
ggaaataatgattttttaaaaaagaaagggaaagatttaattaatttcagtaaaaggagg
aaagtggctgaaattactggagaaattcagcagtatcagaatcaaccttactgtttacgg
attgaaccagaaatgaggcgattctttgaaaaccttaaccccatgggaagtgcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcccaggaaatcaactttctctttaaagtctccgggaataaggcct
aatacaggtcgacatggctctacctcaggcactttacgaggtcatccaacaccattagaa
agagaaccatgtaaaataagctttagccggattgctgaaactgagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggcagcaacagcatctttgctcca
gtccttttgccacattcaaaggctttcttcagttcgtgtggtagtttacataaactaagt
gaagagctgctgattcctcctcctcttcctcctcgaaaaaaatttgatcatgatgcttca
aattccaagggaaatatgaaatctgatgatgacccccctgctattccaccaagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcatttgatgggcctctg
cctagtccacctccaccgccgccgagagatcctcttcctgatactcctccaccagttccc
tttcggcctccagaacactttataaactgtccatttaaccttcagccacctccactggga
catcttcacagagatccagactggttcagagacgttagcacatgtccaaattcgccaaac
actcctcctagcacaccctctccaaggataccacgtcgatgctgtgtgctcagttctagt
cacaataatcttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttacaaacgggagctttcacaccccccattgtat
agactgcctttgctggaaaacgcagaaactcctcaatga

KEGG   Miniopterus natalensis: 107541780
Entry
107541780         CDS       T05883                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04068  FoxO signaling pathway
mna04072  Phospholipase D signaling pathway
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04714  Thermogenesis
mna04722  Neurotrophin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05034  Alcoholism
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107541780 (SOS1)
   04012 ErbB signaling pathway
    107541780 (SOS1)
   04014 Ras signaling pathway
    107541780 (SOS1)
   04630 JAK-STAT signaling pathway
    107541780 (SOS1)
   04068 FoxO signaling pathway
    107541780 (SOS1)
   04072 Phospholipase D signaling pathway
    107541780 (SOS1)
   04151 PI3K-Akt signaling pathway
    107541780 (SOS1)
   04150 mTOR signaling pathway
    107541780 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107541780 (SOS1)
   04540 Gap junction
    107541780 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107541780 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107541780 (SOS1)
   04660 T cell receptor signaling pathway
    107541780 (SOS1)
   04662 B cell receptor signaling pathway
    107541780 (SOS1)
   04664 Fc epsilon RI signaling pathway
    107541780 (SOS1)
   04062 Chemokine signaling pathway
    107541780 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107541780 (SOS1)
   04912 GnRH signaling pathway
    107541780 (SOS1)
   04915 Estrogen signaling pathway
    107541780 (SOS1)
   04917 Prolactin signaling pathway
    107541780 (SOS1)
   04926 Relaxin signaling pathway
    107541780 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    107541780 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107541780 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107541780 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541780 (SOS1)
   05206 MicroRNAs in cancer
    107541780 (SOS1)
   05205 Proteoglycans in cancer
    107541780 (SOS1)
   05231 Choline metabolism in cancer
    107541780 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107541780 (SOS1)
   05225 Hepatocellular carcinoma
    107541780 (SOS1)
   05226 Gastric cancer
    107541780 (SOS1)
   05214 Glioma
    107541780 (SOS1)
   05221 Acute myeloid leukemia
    107541780 (SOS1)
   05220 Chronic myeloid leukemia
    107541780 (SOS1)
   05211 Renal cell carcinoma
    107541780 (SOS1)
   05215 Prostate cancer
    107541780 (SOS1)
   05213 Endometrial cancer
    107541780 (SOS1)
   05224 Breast cancer
    107541780 (SOS1)
   05223 Non-small cell lung cancer
    107541780 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    107541780 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107541780 (SOS1)
   05160 Hepatitis C
    107541780 (SOS1)
   05163 Human cytomegalovirus infection
    107541780 (SOS1)
   05165 Human papillomavirus infection
    107541780 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107541780 (SOS1)
   01522 Endocrine resistance
    107541780 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107541780 (SOS1)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107541780 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 107541780
NCBI-ProteinID: XP_016074427
LinkDB
Position
Unknown
AA seq 1276 aa
MLCQAQPRSVSDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEV
LGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
QDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLF
SANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYES
YARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELL
KQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQL
AIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQ
PRLPGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNW
MAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAG
IPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTE
ADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDAYLLQRMEEF
IGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTIEWHISRPGHIETFDLL
TLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEK
CIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQ
KKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELIN
FSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIE
PRNPKPLPRFPKKYNYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTA
SAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLSHGPRSASVSS
ISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYS
ISDRTSISDAPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFT
PPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHP
SMHRDGPPLLENAHSS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atgctatgccaagctcagccccgaagtgtttcagatgtagaggaacgtgttcaaaaaagt
tttcctcatccaattgataagtgggcaatagctgatgcccagtctgctatagaaaagagg
aagcgaagaaaccctttatctctcccagtagaaaaaattcatcctttattaaaggaagtc
ctaggttataaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatt
tctgcagacattttaaagctggtggggaattatgtacgaaatatacggcattatgaaatt
acaaaacaagatattaaagtagcaatgtgtgctgataaggtattgatggatatgtttcat
caagatgtagaagatataaatatattatctttaactgatgaagagccttccacctcagga
gagcaaacatattatgatttggtaaaagcatttatggcagaaattcgacaatacataagg
gagctaaatttaattataaaagtttttagagagccctttgtctccaattcaaaattgttt
tcggctaacgatgtagaaaatatatttagtcgaatagtagatatacatgaacttagtgta
aagttactgggccatatagaagatactgtagaaatgacagatgaaggcagtccccatcca
ctagtaggaagctgctttgaagacttagcagaggaactggcatttgatccgtatgaatca
tatgctcgagatattttacgacctggttttcatgatcgtttccttagtcagttatcaaag
cctggagcagcactttatttacagtcaataggcgaaggtttcaaagaagcggttcaatat
gttttacccaggctgcttctagccccggtttaccactgtctacattactttgaactttta
aagcagttagaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaata
acagctttacttaatgttcagagtggtatggaaaaaatatgttctaaaagccttgcgaaa
cgaaggctgagtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaacta
gcaatcaagaaaatgaatgagattcagaagaatattgatggttgggagggaaaagacatt
ggacagtgttgcaatgagtttataatggaaggaactcttacacgtgtaggagccaaacat
gagagacacatatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcag
ccaagacttcctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgaga
aaggtacaaattaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataatt
ttaaaagatgaaaatagtgttatattttctgccaagtcagctgaagagaagaacaattgg
atggcagcattgatatctttacagtaccggagtacactggaaaggatgcttgatgtgaca
atgctacaggaagagaaggaggagcagatgaggctccctagtgctgacgtttatagattt
gcagagcctgactctgaagagaatataatatttgaagaaaacatgcagcccaaggctgga
attccaattatcaaagcaggaactgttattaaactcatagagaggctcacataccatatg
tatgcagatcccaattttgttcggacatttcttacaacatacagatccttttgtaaacct
caagaactactgagccttataatagaaaggtttgaaattccagagcctgagccaacagaa
gctgatcgcatagctatagagaatggagatcagcccttgagtgcagaactaaaaaggttt
agaaaagaatatatacagcctgtacaactgcgagtgttaaatgtgtgtcggcattgggta
gagcaccacttctatgactttgaaagagatgcatatcttttgcaacgaatggaggaattt
attggaacagtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatc
caaaggaaaaaaattgcaagagacaatggaccaggtcataatattacatttcagagttca
cctcccacaattgagtggcatataagccgacctgggcacatagagacttttgacctgctt
accttacacccaatagaaattgctcggcaactcactttacttgaatcagacctataccga
gctgtacagccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaat
tctcctaatcttctgaaaatgatccggcacaccactaatctcactctgtggtttgagaaa
tgtatcgtagaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgag
attctgcaagtctttcaagagctgaacaacttcaatggtgtccttgaagttgtcagtgct
atgaattcatcacctgtttacaggctagatcacacatttgagcaaataccaagtcgccaa
aagaaaattttagaagaagctcatgaattaagtgaagatcattataagaaatatttggca
aaactcaggtctataaatccaccatgtgtgcctttctttggaatttatctaactaatatc
ttgaaaacagaagaaggcaaccctgaggttctaaaaaggcatggaaaagagcttataaac
tttagcaaaaggaggaaagtggcagaaataacaggagagatccagcagtaccaaaaccag
ccttattgtctacgagtagaatcagatatcaagaggttctttgaaaacttgaatccaatg
ggaaatagcatggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaa
ccacgaaaccctaagcctctcccaagatttccaaaaaaatataactatcccctaaaatct
cctggtgttcgtccatcaaacccaagaccaggtaccatgagacatcccacaccgctgcag
caggagccaaggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagca
tctgcaccaaattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagt
accacagatgtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagc
gataccgtctttatccaagttacactgtcccatggcccaagatctgcttcagtatcatct
ataagcttaaccaagggcactgatgaagtgcctgtcccccctccagttcctccacgaaga
agaccagagtctgccccagcggaatcttcaccatctaagattatgtctaagcatttggac
agccctccagcaattcctcctaggcaacccacatcaaaagcctattcaccacgatactcg
atatcagaccggacctctatatcagatgctcctgaaagccctcccttattaccaccacga
gaacctgtgaggacacctgatgttttctcaagctcaccactacacctccaacctccccct
ttgggcaaaaaaagtgatcacggcaatgccttctttccaaacagcccttcccccttcaca
ccacctcctcctcaaacaccttctcctcatggcacgagaaggcatctgccatcgccacca
ttgacacaagaagtggaccttcattccattgctgggccacctgttcctccacgacaaagc
acttctcagcatatccctaaactccctccaaaaacttacaaaagggagcacacacaccct
tccatgcacagagatggaccaccgctgttggagaatgcccattcctcctga

DBGET integrated database retrieval system