KEGG   Miniopterus natalensis: 107525867
Entry
107525867         CDS       T05883                                 

Gene name
GNG2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
  KO
K07826  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107525867 (GNG2)
   04371 Apelin signaling pathway
    107525867 (GNG2)
   04151 PI3K-Akt signaling pathway
    107525867 (GNG2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107525867 (GNG2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107525867 (GNG2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107525867 (GNG2)
   04727 GABAergic synapse
    107525867 (GNG2)
   04725 Cholinergic synapse
    107525867 (GNG2)
   04728 Dopaminergic synapse
    107525867 (GNG2)
   04726 Serotonergic synapse
    107525867 (GNG2)
   04723 Retrograde endocannabinoid signaling
    107525867 (GNG2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107525867 (GNG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525867 (GNG2)
  09165 Substance dependence
   05032 Morphine addiction
    107525867 (GNG2)
   05034 Alcoholism
    107525867 (GNG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107525867 (GNG2)
   05163 Human cytomegalovirus infection
    107525867 (GNG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107525867 (GNG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107525867 (GNG2)
   04031 GTP-binding proteins [BR:mna04031]
    107525867 (GNG2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107525867 (GNG2)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107525867 (GNG2)
SSDB
Motif
Pfam: G-gamma FtsX_ECD CP12 CHASE8
Other DBs
NCBI-GeneID: 107525867
NCBI-ProteinID: XP_016053598
LinkDB
Position
Unknown
AA seq 71 aa
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
NT seq 216 nt   +upstreamnt  +downstreamnt
atggccagcaacaacactgccagcatagcacaagccaggaagctggtggaacagctgaag
atggaagccaacattgacaggataaaggtatccaaggcagctgcggacttgatggcctac
tgtgaagctcatgccaaggaagacccgctcctgacccccgttccggcttcagagaaccca
tttagggagaagaagttcttctgtgccatcctttaa

KEGG   Miniopterus natalensis: 107527185
Entry
107527185         CDS       T05883                                 

Gene name
GNG4
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
  KO
K04541  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107527185 (GNG4)
   04371 Apelin signaling pathway
    107527185 (GNG4)
   04151 PI3K-Akt signaling pathway
    107527185 (GNG4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107527185 (GNG4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107527185 (GNG4)
  09156 Nervous system
   04724 Glutamatergic synapse
    107527185 (GNG4)
   04727 GABAergic synapse
    107527185 (GNG4)
   04725 Cholinergic synapse
    107527185 (GNG4)
   04728 Dopaminergic synapse
    107527185 (GNG4)
   04726 Serotonergic synapse
    107527185 (GNG4)
   04723 Retrograde endocannabinoid signaling
    107527185 (GNG4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107527185 (GNG4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527185 (GNG4)
  09165 Substance dependence
   05032 Morphine addiction
    107527185 (GNG4)
   05034 Alcoholism
    107527185 (GNG4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107527185 (GNG4)
   05163 Human cytomegalovirus infection
    107527185 (GNG4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107527185 (GNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107527185 (GNG4)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107527185 (GNG4)
SSDB
Motif
Pfam: G-gamma ATP-synt_F
Other DBs
NCBI-GeneID: 107527185
NCBI-ProteinID: XP_016055348
LinkDB
Position
Unknown
AA seq 75 aa
MKEGMSSNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHAREDPLIVPVPA
SENPFREKKFFCTIL
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaggagggcatgtccagcaacagcaccaccagcatctcgcaggcccgcaaggccgtg
gagcagctcaagatggaagcctgcatggacagggtgaaggtgtcccaggcagctgcggac
ctcctggcatactgtgaggcccacgcccgggaggaccctctgatcgtccccgtgcctgcg
tcagaaaacccgttccgagagaagaagttcttctgtaccatcctctga

KEGG   Miniopterus natalensis: 107533363
Entry
107533363         CDS       T05883                                 

Gene name
GNG13
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
  KO
K04547  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107533363 (GNG13)
   04371 Apelin signaling pathway
    107533363 (GNG13)
   04151 PI3K-Akt signaling pathway
    107533363 (GNG13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107533363 (GNG13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107533363 (GNG13)
  09156 Nervous system
   04724 Glutamatergic synapse
    107533363 (GNG13)
   04727 GABAergic synapse
    107533363 (GNG13)
   04725 Cholinergic synapse
    107533363 (GNG13)
   04728 Dopaminergic synapse
    107533363 (GNG13)
   04726 Serotonergic synapse
    107533363 (GNG13)
   04723 Retrograde endocannabinoid signaling
    107533363 (GNG13)
  09157 Sensory system
   04740 Olfactory transduction
    107533363 (GNG13)
   04742 Taste transduction
    107533363 (GNG13)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107533363 (GNG13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533363 (GNG13)
  09165 Substance dependence
   05032 Morphine addiction
    107533363 (GNG13)
   05034 Alcoholism
    107533363 (GNG13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107533363 (GNG13)
   05163 Human cytomegalovirus infection
    107533363 (GNG13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107533363 (GNG13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107533363 (GNG13)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107533363 (GNG13)
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 107533363
NCBI-ProteinID: XP_016063500
LinkDB
Position
Unknown
AA seq 67 aa
MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCAIL
NT seq 204 nt   +upstreamnt  +downstreamnt
atggaggagtgggacgtgccccagatgaagaaggaggtcgagagcctcaagtaccagctg
gccttcaaaagggagatgtcatccaagaccatccctgagctcctcaagtggatcgaggat
gggatccccaaggaccccttcctgaaccctgacctcatgaagaacaacccgtgggtggag
aagggcaagtgtgccatcctgtga

KEGG   Miniopterus natalensis: 107533406
Entry
107533406         CDS       T05883                                 

Gene name
GNG12
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04810  Regulation of actin cytoskeleton
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107533406 (GNG12)
   04014 Ras signaling pathway
    107533406 (GNG12)
   04371 Apelin signaling pathway
    107533406 (GNG12)
   04151 PI3K-Akt signaling pathway
    107533406 (GNG12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107533406 (GNG12)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107533406 (GNG12)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107533406 (GNG12)
  09156 Nervous system
   04724 Glutamatergic synapse
    107533406 (GNG12)
   04727 GABAergic synapse
    107533406 (GNG12)
   04725 Cholinergic synapse
    107533406 (GNG12)
   04728 Dopaminergic synapse
    107533406 (GNG12)
   04726 Serotonergic synapse
    107533406 (GNG12)
   04723 Retrograde endocannabinoid signaling
    107533406 (GNG12)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107533406 (GNG12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533406 (GNG12)
  09165 Substance dependence
   05032 Morphine addiction
    107533406 (GNG12)
   05034 Alcoholism
    107533406 (GNG12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107533406 (GNG12)
   05163 Human cytomegalovirus infection
    107533406 (GNG12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107533406 (GNG12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107533406 (GNG12)
   04031 GTP-binding proteins [BR:mna04031]
    107533406 (GNG12)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107533406 (GNG12)
  Exosomal proteins of colorectal cancer cells
   107533406 (GNG12)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107533406 (GNG12)
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 107533406
NCBI-ProteinID: XP_016063578
LinkDB
Position
Unknown
AA seq 72 aa
MSSKTASTNNLTQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
NT seq 219 nt   +upstreamnt  +downstreamnt
atgtcaagcaaaaccgcaagcaccaacaacctcacccaggccaggagaactgtgcagcag
ttaagactagaagcctccattgaaagaataaaggtttccaaggcgtcggctgacctcatg
tcctactgcgaggagcatgccaggagtgaccctctgctgatagggataccaacctcagaa
aaccctttcaaggataaaaaaacatgcatcatcttatag

KEGG   Miniopterus natalensis: 107534609
Entry
107534609         CDS       T05883                                 

Gene name
GNG7
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
  KO
K04543  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107534609 (GNG7)
   04371 Apelin signaling pathway
    107534609 (GNG7)
   04151 PI3K-Akt signaling pathway
    107534609 (GNG7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107534609 (GNG7)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107534609 (GNG7)
  09156 Nervous system
   04724 Glutamatergic synapse
    107534609 (GNG7)
   04727 GABAergic synapse
    107534609 (GNG7)
   04725 Cholinergic synapse
    107534609 (GNG7)
   04728 Dopaminergic synapse
    107534609 (GNG7)
   04726 Serotonergic synapse
    107534609 (GNG7)
   04723 Retrograde endocannabinoid signaling
    107534609 (GNG7)
  09157 Sensory system
   04740 Olfactory transduction
    107534609 (GNG7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107534609 (GNG7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534609 (GNG7)
  09165 Substance dependence
   05032 Morphine addiction
    107534609 (GNG7)
   05034 Alcoholism
    107534609 (GNG7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107534609 (GNG7)
   05163 Human cytomegalovirus infection
    107534609 (GNG7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107534609 (GNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107534609 (GNG7)
   04031 GTP-binding proteins [BR:mna04031]
    107534609 (GNG7)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107534609 (GNG7)
  Exosomal proteins of other body fluids (saliva and urine)
   107534609 (GNG7)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107534609 (GNG7)
SSDB
Motif
Pfam: G-gamma CP12 FtsX_ECD
Other DBs
NCBI-GeneID: 107534609
NCBI-ProteinID: XP_016065255
LinkDB
Position
Unknown
AA seq 68 aa
MSATNNIAQARKLVEQLRIEAGIQRIKVSKASSELMSYCEQHARNDPLLVGVPASENPFK
DKKPCVIL
NT seq 207 nt   +upstreamnt  +downstreamnt
atgtcagccactaacaacatcgcccaggccaggaaactggtggagcagctccgcatcgaa
gccgggatccagcgcatcaaggtctccaaagcctcatcggaactcatgagttactgtgag
cagcatgcccggaacgaccccctgctggtcggagtccctgcctccgagaaccccttcaag
gacaagaagccttgtgtcattctatag

KEGG   Miniopterus natalensis: 107536795
Entry
107536795         CDS       T05883                                 

Gene name
GNG8
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8
  KO
K04544  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107536795 (GNG8)
   04371 Apelin signaling pathway
    107536795 (GNG8)
   04151 PI3K-Akt signaling pathway
    107536795 (GNG8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107536795 (GNG8)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107536795 (GNG8)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536795 (GNG8)
   04727 GABAergic synapse
    107536795 (GNG8)
   04725 Cholinergic synapse
    107536795 (GNG8)
   04728 Dopaminergic synapse
    107536795 (GNG8)
   04726 Serotonergic synapse
    107536795 (GNG8)
   04723 Retrograde endocannabinoid signaling
    107536795 (GNG8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107536795 (GNG8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536795 (GNG8)
  09165 Substance dependence
   05032 Morphine addiction
    107536795 (GNG8)
   05034 Alcoholism
    107536795 (GNG8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107536795 (GNG8)
   05163 Human cytomegalovirus infection
    107536795 (GNG8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107536795 (GNG8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107536795 (GNG8)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107536795 (GNG8)
SSDB
Motif
Pfam: G-gamma Flexi_CP
Other DBs
NCBI-GeneID: 107536795
NCBI-ProteinID: XP_016068119
LinkDB
Position
Unknown
AA seq 70 aa
MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPF
RDKRLFCVLL
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtccaacaacatggccaaaatcgcggaagcccgcaagacggtggaacagctgaagctg
gaggtgaacatcgaccgcatgaaggtgtcgcaggcggcggcggagctcctggccttctgc
gagacgcacgccaaggacgacccgctggtgacgccggtccccgccgcggagaaccccttc
cgcgacaagcgccttttctgcgtcctgctctga

KEGG   Miniopterus natalensis: 107537622
Entry
107537622         CDS       T05883                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10-like
  KO
K04545  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107537622
   04371 Apelin signaling pathway
    107537622
   04151 PI3K-Akt signaling pathway
    107537622
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107537622
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107537622
  09156 Nervous system
   04724 Glutamatergic synapse
    107537622
   04727 GABAergic synapse
    107537622
   04725 Cholinergic synapse
    107537622
   04728 Dopaminergic synapse
    107537622
   04726 Serotonergic synapse
    107537622
   04723 Retrograde endocannabinoid signaling
    107537622
  09159 Environmental adaptation
   04713 Circadian entrainment
    107537622
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537622
  09165 Substance dependence
   05032 Morphine addiction
    107537622
   05034 Alcoholism
    107537622
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107537622
   05163 Human cytomegalovirus infection
    107537622
   05167 Kaposi sarcoma-associated herpesvirus infection
    107537622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107537622
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107537622
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 107537622
NCBI-ProteinID: XP_016069157
LinkDB
Position
Unknown
AA seq 87 aa
MTRVDRRCRRRPRGLDSAASLHSDWNAPYPPKGPFFALEKPLRSCWVSQAAAELQQYCMQ
NACKDALLVGVPAGSNPFREPRSCALL
NT seq 264 nt   +upstreamnt  +downstreamnt
atgacgcgagtggaccggcgatgccggcgacgcccccgcggcctggactcggctgcatcc
cttcacagtgattggaatgctccatatcctcccaaaggccccttctttgctttggagaag
cctctcagaagttgctgggtctctcaggcggctgcagagctccagcagtactgcatgcag
aacgcctgcaaggatgccctgctggtcggtgttcccgcaggaagcaaccccttcagggag
cccagatcctgtgctctgctctga

KEGG   Miniopterus natalensis: 107539173
Entry
107539173         CDS       T05883                                 

Gene name
GNGT2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
  KO
K04549  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107539173 (GNGT2)
   04371 Apelin signaling pathway
    107539173 (GNGT2)
   04151 PI3K-Akt signaling pathway
    107539173 (GNGT2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107539173 (GNGT2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107539173 (GNGT2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107539173 (GNGT2)
   04727 GABAergic synapse
    107539173 (GNGT2)
   04725 Cholinergic synapse
    107539173 (GNGT2)
   04728 Dopaminergic synapse
    107539173 (GNGT2)
   04726 Serotonergic synapse
    107539173 (GNGT2)
   04723 Retrograde endocannabinoid signaling
    107539173 (GNGT2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107539173 (GNGT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539173 (GNGT2)
  09165 Substance dependence
   05032 Morphine addiction
    107539173 (GNGT2)
   05034 Alcoholism
    107539173 (GNGT2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107539173 (GNGT2)
   05163 Human cytomegalovirus infection
    107539173 (GNGT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107539173 (GNGT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107539173 (GNGT2)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107539173 (GNGT2)
SSDB
Motif
Pfam: G-gamma Myc-LZ
Other DBs
NCBI-GeneID: 107539173
NCBI-ProteinID: XP_016071082
LinkDB
Position
Unknown
AA seq 69 aa
MAQELSEKELLRMEVEQLKKEARNPRAPISKTGREIKGYVEAHAGNDPLLKGISEDKNPF
KEKGTCMIN
NT seq 210 nt   +upstreamnt  +downstreamnt
atggcccaggagctcagcgagaaggagctactgaggatggaagtggagcagctgaagaag
gaagcgaggaacccaagggctccgatttccaagacaggaagggaaatcaagggttatgtg
gaggcccacgcagggaacgaccctcttctcaaaggcatctctgaggacaagaaccccttc
aaggagaaaggcacttgtatgataaactga

KEGG   Miniopterus natalensis: 107540160
Entry
107540160         CDS       T05883                                 

Gene name
GNB1
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
  KO
K04536  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04744  Phototransduction
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107540160 (GNB1)
   04371 Apelin signaling pathway
    107540160 (GNB1)
   04151 PI3K-Akt signaling pathway
    107540160 (GNB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107540160 (GNB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107540160 (GNB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107540160 (GNB1)
   04727 GABAergic synapse
    107540160 (GNB1)
   04725 Cholinergic synapse
    107540160 (GNB1)
   04728 Dopaminergic synapse
    107540160 (GNB1)
   04726 Serotonergic synapse
    107540160 (GNB1)
   04723 Retrograde endocannabinoid signaling
    107540160 (GNB1)
  09157 Sensory system
   04744 Phototransduction
    107540160 (GNB1)
   04740 Olfactory transduction
    107540160 (GNB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107540160 (GNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540160 (GNB1)
  09165 Substance dependence
   05032 Morphine addiction
    107540160 (GNB1)
   05034 Alcoholism
    107540160 (GNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107540160 (GNB1)
   05163 Human cytomegalovirus infection
    107540160 (GNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107540160 (GNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107540160 (GNB1)
   04031 GTP-binding proteins [BR:mna04031]
    107540160 (GNB1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107540160 (GNB1)
  Exosomal proteins of colorectal cancer cells
   107540160 (GNB1)
  Exosomal proteins of melanoma cells
   107540160 (GNB1)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    107540160 (GNB1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A Cytochrom_D1 CALM_bind
Other DBs
NCBI-GeneID: 107540160
NCBI-ProteinID: XP_016072336
LinkDB
Position
Unknown
AA seq 340 aa
MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNVDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF
TGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRADQELMIYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL
KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtgagcttgaccagctgcggcaggaggccgagcagctgaaaaaccagatccgagat
gccaggaaagcatgtgcagatgcaacactctctcagatcacaaacaacgtggaccctgtg
ggaaggatccagatgcgcaccaggagaacgctgcgggggcacctggccaaaatctacgct
atgcactggggcacagattccaggcttctcgtgagtgcctctcaggatggtaaactcatc
atctgggacagctacaccacaaacaaggtccacgctattcctctgcgctcctcgtgggtc
atgacctgtgcgtatgccccttctgggaactacgtggcctgtggtggcctggataacatt
tgctccatttacaacctgaagactcgcgaaggaaatgtgcgtgtgagtcgtgaactagcc
ggacacacaggttacctgtcctgctgccgcttcctggacgacaatcagattgttaccagc
tctggagacaccacctgtgctctgtgggacattgagacgggtcagcagacgaccacgttc
acgggacacaccggggacgtcatgagcctctctctcgctcctgacaccaggctgtttgtg
tccggtgcttgtgatgcttccgctaaactctgggatgtgcgagaagggatgtgccggcaa
accttcaccggccacgagtctgacatcaatgccatctgtttctttccaaatggcaacgca
tttgccactggctcggatgacgccacctgcaggctgttcgaccttcgtgcggatcaggag
ctcatgatttactcccacgacaacatcatatgtgggatcacctccgtctccttctccaag
agtgggcgcctcctcctcgcggggtacgatgacttcaactgcaacgtctgggatgcgctc
aaagccgacagggcaggtgtcttggccgggcatgacaaccgcgtcagctgcctgggggtg
actgacgatgggatggccgtggcgacagggtcctgggatagcttcctcaagatctggaac
taa

KEGG   Miniopterus natalensis: 107540752
Entry
107540752         CDS       T05883                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04360  Axon guidance
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05133  Pertussis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107540752 (GNAI1)
   04371 Apelin signaling pathway
    107540752 (GNAI1)
   04071 Sphingolipid signaling pathway
    107540752 (GNAI1)
   04024 cAMP signaling pathway
    107540752 (GNAI1)
   04022 cGMP-PKG signaling pathway
    107540752 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107540752 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107540752 (GNAI1)
   04670 Leukocyte transendothelial migration
    107540752 (GNAI1)
   04062 Chemokine signaling pathway
    107540752 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107540752 (GNAI1)
   04915 Estrogen signaling pathway
    107540752 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    107540752 (GNAI1)
   04921 Oxytocin signaling pathway
    107540752 (GNAI1)
   04926 Relaxin signaling pathway
    107540752 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    107540752 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    107540752 (GNAI1)
   04916 Melanogenesis
    107540752 (GNAI1)
   04924 Renin secretion
    107540752 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107540752 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    107540752 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107540752 (GNAI1)
   04727 GABAergic synapse
    107540752 (GNAI1)
   04725 Cholinergic synapse
    107540752 (GNAI1)
   04728 Dopaminergic synapse
    107540752 (GNAI1)
   04726 Serotonergic synapse
    107540752 (GNAI1)
   04730 Long-term depression
    107540752 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    107540752 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    107540752 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107540752 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540752 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107540752 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    107540752 (GNAI1)
   05032 Morphine addiction
    107540752 (GNAI1)
   05034 Alcoholism
    107540752 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107540752 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107540752 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107540752 (GNAI1)
   05163 Human cytomegalovirus infection
    107540752 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107540752 (GNAI1)
   05142 Chagas disease
    107540752 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107540752 (GNAI1)
   04031 GTP-binding proteins [BR:mna04031]
    107540752 (GNAI1)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107540752 (GNAI1)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107540752 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 107540752
NCBI-ProteinID: XP_016073061
LinkDB
Position
Unknown
AA seq 302 aa
MKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAG
AAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQ
DVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDL
VLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICYPEYAG
SNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCG
LF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaaattatccacgaagctggttattcggaagaagaatgtaaacagtacaaggcagtg
gtctacagtaacaccattcagtccattattgctatcattagagccatgggaaggttgaag
atagacttcggtgactcagctcgggcggatgatgcccgtcaactctttgtgcttgctgga
gctgctgaagaaggattcatgactgcagaacttgctggcgttataaagagattgtggaaa
gatagtggtgtacaagcctgtttcaacagatcccgagagtaccagcttaatgattctgca
gcatactatttgaatgacttggacagaatagcacagccaaattacatcccaactcaacaa
gatgttctcagaacacgagtgaaaaccacaggaattgttgaaacccactttactttcaaa
gatcttcactttaagatgtttgatgtgggaggacagaggtctgagcggaagaaatggatc
cattgctttgaaggagtcactgccatcattttctgtgtggcactgagtgactatgacctg
gttctagctgaagatgaagaaatgaatcgaatgcatgaaagcatgaagttattcgacagc
atatgtaacaacaaatggtttacagaaacatctattatactttttctaaacaagaaggat
ctcttcgaagaaaaaatcaaaaagagccctctcactatatgctatccagaatatgcaggc
tcaaacacatatgaagaggcagctgcatatattcagtgtcagtttgaagatctcaataaa
aggaaggacacaaaggaaatatacacccacttcacatgtgccacagatactaagaatgtg
cagtttgtttttgatgccgtaacagatgtcatcataaaaaataatctaaaagattgtggt
ctcttctaa

KEGG   Miniopterus natalensis: 107540939
Entry
107540939         CDS       T05883                                 

Gene name
GNB2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107540939 (GNB2)
   04371 Apelin signaling pathway
    107540939 (GNB2)
   04151 PI3K-Akt signaling pathway
    107540939 (GNB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107540939 (GNB2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107540939 (GNB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107540939 (GNB2)
   04727 GABAergic synapse
    107540939 (GNB2)
   04725 Cholinergic synapse
    107540939 (GNB2)
   04728 Dopaminergic synapse
    107540939 (GNB2)
   04726 Serotonergic synapse
    107540939 (GNB2)
   04723 Retrograde endocannabinoid signaling
    107540939 (GNB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107540939 (GNB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540939 (GNB2)
  09165 Substance dependence
   05032 Morphine addiction
    107540939 (GNB2)
   05034 Alcoholism
    107540939 (GNB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107540939 (GNB2)
   05163 Human cytomegalovirus infection
    107540939 (GNB2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107540939 (GNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107540939 (GNB2)
   04031 GTP-binding proteins [BR:mna04031]
    107540939 (GNB2)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107540939 (GNB2)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    107540939 (GNB2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like CALM_bind
Other DBs
NCBI-GeneID: 107540939
NCBI-ProteinID: XP_016073316
LinkDB
Position
Unknown
AA seq 340 aa
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVAF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggattcaacactgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacacggaggactctccgtgggcacctggcaaaaatctatgcg
atgcactgggggacagactcaaggctgctggtcagcgcctcccaggatgggaagctcatc
atttgggacagctataccaccaacaaggtccatgccatcccgctacgttcctcctgggtt
atgacctgtgcctatgcgccctcagggaactttgtggcctgtggggggttggacaacatc
tgctccatctacagcctcaagacccgtgagggcaatgtcagggtcagccgagagctgcct
ggccataccgggtacctgtcctgctgccgcttcctggatgacaaccaaatcatcaccagt
tctggggacaccacctgtgccctgtgggacattgagacaggccagcagacagtggctttt
gctggacacagtggggatgtgatgtccttgtcactggcccccgatggccgcacctttgtg
tcaggtgcctgtgatgcctctatcaagctgtgggatgtgcgggattcgatgtgccgacag
accttcattggccacgaatcggacatcaatgccgtggctttcttccctaacggctatgcc
tttaccaccggctctgacgatgccacgtgccgcctcttcgacctgcgggctgaccaggag
ctcctcatgtattcccacgacaacatcatctgcggcatcacctctgttgccttctctcgc
agtggccggctgctgcttgctggctacgatgacttcaactgcaacatctgggatgccatg
aagggcgaccgtgcaggtgtccttgctggccatgacaaccgtgtgagctgcctcggggta
actgatgatggcatggctgtggccacaggctcctgggactccttcctcaagatctggaac
taa

KEGG   Miniopterus natalensis: 107541113
Entry
107541113         CDS       T05883                                 

Gene name
GNB4
Definition
(RefSeq) guanine nucleotide-binding protein subunit beta-4
  KO
K04538  guanine nucleotide-binding protein subunit beta-4
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107541113 (GNB4)
   04371 Apelin signaling pathway
    107541113 (GNB4)
   04151 PI3K-Akt signaling pathway
    107541113 (GNB4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107541113 (GNB4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107541113 (GNB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    107541113 (GNB4)
   04727 GABAergic synapse
    107541113 (GNB4)
   04725 Cholinergic synapse
    107541113 (GNB4)
   04728 Dopaminergic synapse
    107541113 (GNB4)
   04726 Serotonergic synapse
    107541113 (GNB4)
   04723 Retrograde endocannabinoid signaling
    107541113 (GNB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107541113 (GNB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541113 (GNB4)
  09165 Substance dependence
   05032 Morphine addiction
    107541113 (GNB4)
   05034 Alcoholism
    107541113 (GNB4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107541113 (GNB4)
   05163 Human cytomegalovirus infection
    107541113 (GNB4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541113 (GNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107541113 (GNB4)
   04031 GTP-binding proteins [BR:mna04031]
    107541113 (GNB4)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107541113 (GNB4)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    107541113 (GNB4)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like
Other DBs
NCBI-GeneID: 107541113
NCBI-ProteinID: XP_016073571
LinkDB
Position
Unknown
AA seq 340 aa
MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYA
MHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELPGHIGYLSCCRFLDDSQIVTSSGDTNCALWDIETAQQTTTF
TGHSGDVMSLSLSPDMRTFVSGACDASAKLWDIRDGMCRQSFSGHVSDINAVSFFPNGYA
FATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTL
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtgaactggaacagttgaggcaggaagctgaacagctacggaatcagatccaggat
gctaggaaagcatgtaatgacgcaacgcttgttcagatcacatcaaatatggattctgtg
ggtcggatacaaatgcgaacaagacgtacactgagggggcacctcgctaagatctacgcc
atgcactggggctatgattcaaggctactagtcagtgcttcccaagatggaaaattaatt
atttgggatagctatacaacaaataagatgcatgctattcccctgaggtcctcctgggtg
atgacctgcgcctacgctccctcgggaaattacgtggcctgtggaggactggacaacatc
tgctccatatataacttaaagaccagagaggggaatgtgagagtgagccgagagttgccg
ggtcacataggctacttgtcctgctgtcgttttttagacgacagccaaattgttacaagt
tcaggagatacaaattgtgctttatgggacattgaaactgcccagcagaccaccacattc
actgggcattctggagatgtgatgagtctttctctgagtcctgacatgagaacttttgtt
tctggtgcttgtgatgcctctgccaagttatgggatattcgagatggaatgtgtagacag
tctttctctggacatgtgtcagatattaatgctgtcagtttttttccgaatggatatgcc
tttgccactggctccgatgatgccacttgccgcctctttgaccttcgtgcagaccaggag
ttattattgtattctcatgacaatattatctgtggaatcacctctgtagccttctcaaaa
agtgggcgcctcctgttagctggttatgatgactttaattgtaatgtatgggacacactg
aaaggagatcgtgcaggtgttcttgctggtcatgacaaccgtgtcagctgtttgggtgta
actgatgatggcatggctgtggcaacaggctcttgggacagttttcttagaatctggaat
taa

KEGG   Miniopterus natalensis: 107541527
Entry
107541527         CDS       T05883                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7-like
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04810  Regulation of actin cytoskeleton
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107541527
   04014 Ras signaling pathway
    107541527
   04371 Apelin signaling pathway
    107541527
   04151 PI3K-Akt signaling pathway
    107541527
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107541527
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107541527
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107541527
  09156 Nervous system
   04724 Glutamatergic synapse
    107541527
   04727 GABAergic synapse
    107541527
   04725 Cholinergic synapse
    107541527
   04728 Dopaminergic synapse
    107541527
   04726 Serotonergic synapse
    107541527
   04723 Retrograde endocannabinoid signaling
    107541527
  09159 Environmental adaptation
   04713 Circadian entrainment
    107541527
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541527
  09165 Substance dependence
   05032 Morphine addiction
    107541527
   05034 Alcoholism
    107541527
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107541527
   05163 Human cytomegalovirus infection
    107541527
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107541527
   04031 GTP-binding proteins [BR:mna04031]
    107541527
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107541527
  Exosomal proteins of colorectal cancer cells
   107541527
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107541527
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 107541527
NCBI-ProteinID: XP_016074102
LinkDB
Position
Unknown
AA seq 80 aa
MALLTLPQMSGKVATGSDIGQARRAVEQLRMEAGINRMKVSKAAADLLQFCMEQAKSDPF
LVGIPAAINPFKEKKPCAIL
NT seq 243 nt   +upstreamnt  +downstreamnt
atggccctgctcacccttcctcagatgtctggcaaagtggccactggcagtgacatcggg
caggcccgccgggcagtggagcagctgaggatggaggccggcatcaaccgcatgaaggtg
tccaaggcggctgctgacctgctgcagttctgcatggagcaggccaagagtgacccgttc
ctggtgggcatcccagctgccatcaaccccttcaaagagaagaagccttgtgccatcctc
tga

KEGG   Miniopterus natalensis: 107541673
Entry
107541673         CDS       T05883                                 

Gene name
GNG11
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
  KO
K04546  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107541673 (GNG11)
   04371 Apelin signaling pathway
    107541673 (GNG11)
   04151 PI3K-Akt signaling pathway
    107541673 (GNG11)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107541673 (GNG11)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107541673 (GNG11)
  09156 Nervous system
   04724 Glutamatergic synapse
    107541673 (GNG11)
   04727 GABAergic synapse
    107541673 (GNG11)
   04725 Cholinergic synapse
    107541673 (GNG11)
   04728 Dopaminergic synapse
    107541673 (GNG11)
   04726 Serotonergic synapse
    107541673 (GNG11)
   04723 Retrograde endocannabinoid signaling
    107541673 (GNG11)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107541673 (GNG11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541673 (GNG11)
  09165 Substance dependence
   05032 Morphine addiction
    107541673 (GNG11)
   05034 Alcoholism
    107541673 (GNG11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107541673 (GNG11)
   05163 Human cytomegalovirus infection
    107541673 (GNG11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541673 (GNG11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107541673 (GNG11)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107541673 (GNG11)
SSDB
Motif
Pfam: G-gamma DUF5660 HAUS5 DUF2508 COG2 Macoilin Cep57_CLD_2
Other DBs
NCBI-GeneID: 107541673
NCBI-ProteinID: XP_016074279
LinkDB
Position
Unknown
AA seq 73 aa
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCIIS
NT seq 222 nt   +upstreamnt  +downstreamnt
atgcccgccctgcacatcgaagatctgccagaaaaggaaaagctgaagatggaagttgag
caacttcgcaaagaagtgaagttgcagagacagcaggtgtctaaatgttccgaagaaata
aaaaactacattgaagaacgttctggggaggatcctctggtgaaaggaattccagaagac
aagaacccctttaaagagaaaggcagctgcattatttcctaa

KEGG   Miniopterus natalensis: 107541750
Entry
107541750         CDS       T05883                                 

Gene name
GNGT1
Definition
(RefSeq) guanine nucleotide-binding protein G(T) subunit gamma-T1
  KO
K04548  guanine nucleotide-binding protein G(T) subunit gamma-T1
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04744  Phototransduction
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107541750 (GNGT1)
   04371 Apelin signaling pathway
    107541750 (GNGT1)
   04151 PI3K-Akt signaling pathway
    107541750 (GNGT1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107541750 (GNGT1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107541750 (GNGT1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107541750 (GNGT1)
   04727 GABAergic synapse
    107541750 (GNGT1)
   04725 Cholinergic synapse
    107541750 (GNGT1)
   04728 Dopaminergic synapse
    107541750 (GNGT1)
   04726 Serotonergic synapse
    107541750 (GNGT1)
   04723 Retrograde endocannabinoid signaling
    107541750 (GNGT1)
  09157 Sensory system
   04744 Phototransduction
    107541750 (GNGT1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107541750 (GNGT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541750 (GNGT1)
  09165 Substance dependence
   05032 Morphine addiction
    107541750 (GNGT1)
   05034 Alcoholism
    107541750 (GNGT1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107541750 (GNGT1)
   05163 Human cytomegalovirus infection
    107541750 (GNGT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541750 (GNGT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107541750 (GNGT1)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107541750 (GNGT1)
SSDB
Motif
Pfam: G-gamma DUF2508 Ribosomal_L27A
Other DBs
NCBI-GeneID: 107541750
NCBI-ProteinID: XP_016074397
LinkDB
Position
Unknown
AA seq 80 aa
MPSKRKMPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSRCCEEVRDYVEARSGEDPLV
KGIPEDKNPFKELKGGCVIS
NT seq 243 nt   +upstreamnt  +downstreamnt
atgccaagcaagcgaaagatgcccgtgatcaatatagaagatctgacagaaaaagacaaa
ttgaagatggaagtggaccagctcaagaaagaagtgacactggaaagaatgctggtatcc
aggtgctgcgaagaggtcagggattatgttgaagcaaggtccggggaggatccgctagta
aagggcatcccagaagacaaaaaccccttcaaggagctcaaaggaggctgcgtgatctca
taa

KEGG   Miniopterus natalensis: 107541861
Entry
107541861         CDS       T05883                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
  KO
K04545  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107541861
   04371 Apelin signaling pathway
    107541861
   04151 PI3K-Akt signaling pathway
    107541861
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107541861
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107541861
  09156 Nervous system
   04724 Glutamatergic synapse
    107541861
   04727 GABAergic synapse
    107541861
   04725 Cholinergic synapse
    107541861
   04728 Dopaminergic synapse
    107541861
   04726 Serotonergic synapse
    107541861
   04723 Retrograde endocannabinoid signaling
    107541861
  09159 Environmental adaptation
   04713 Circadian entrainment
    107541861
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541861
  09165 Substance dependence
   05032 Morphine addiction
    107541861
   05034 Alcoholism
    107541861
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107541861
   05163 Human cytomegalovirus infection
    107541861
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107541861
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107541861
SSDB
Motif
Pfam: G-gamma CP12
Other DBs
NCBI-GeneID: 107541861
NCBI-ProteinID: XP_016074532
LinkDB
Position
Unknown
AA seq 71 aa
MATMPSGASVHALQRLVEQLKLEASVERIKVSQAAAELQQYCMQNACKDVLLVSVPAGSN
PFWGPRSCALL
NT seq 216 nt   +upstreamnt  +downstreamnt
atggccaccatgccttctggggccagcgtgcatgccctgcagcgcctggtggagcagctc
aagctggaggccagtgtggagaggatcaaggtctctcaggcggctgcagagctccagcag
tactgtatgcagaacgcctgcaaggatgtcctgctggttagtgttcccgcagggagcaac
cctttctgggggcccagatcctgtgccctgctctga

KEGG   Miniopterus natalensis: 107543109
Entry
107543109         CDS       T05883                                 

Gene name
GNG3
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
  KO
K04540  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107543109 (GNG3)
   04371 Apelin signaling pathway
    107543109 (GNG3)
   04151 PI3K-Akt signaling pathway
    107543109 (GNG3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107543109 (GNG3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107543109 (GNG3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107543109 (GNG3)
   04727 GABAergic synapse
    107543109 (GNG3)
   04725 Cholinergic synapse
    107543109 (GNG3)
   04728 Dopaminergic synapse
    107543109 (GNG3)
   04726 Serotonergic synapse
    107543109 (GNG3)
   04723 Retrograde endocannabinoid signaling
    107543109 (GNG3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107543109 (GNG3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543109 (GNG3)
  09165 Substance dependence
   05032 Morphine addiction
    107543109 (GNG3)
   05034 Alcoholism
    107543109 (GNG3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107543109 (GNG3)
   05163 Human cytomegalovirus infection
    107543109 (GNG3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107543109 (GNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mna04031]
    107543109 (GNG3)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107543109 (GNG3)
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 107543109
NCBI-ProteinID: XP_016076022
LinkDB
Position
Unknown
AA seq 75 aa
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMSYCDAHACEDPLITPVPT
SENPFREKKFFCALL
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaaggggagacccctgtgaacagcactatgagtattgggcaagcccgcaagatggtg
gaacagcttaagattgaggccagcttgtgtcggataaaggtgtccaaggcagcagcagat
ttgatgtcttactgtgatgcccacgcctgtgaggatcccctcatcacccctgtgcccact
tcggagaaccccttccgggagaagaagttcttctgtgctctcctctga

KEGG   Miniopterus natalensis: 107543194
Entry
107543194         CDS       T05883                                 

Gene name
GNG5
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5
  KO
K04542  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107543194 (GNG5)
   04371 Apelin signaling pathway
    107543194 (GNG5)
   04151 PI3K-Akt signaling pathway
    107543194 (GNG5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107543194 (GNG5)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107543194 (GNG5)
  09156 Nervous system
   04724 Glutamatergic synapse
    107543194 (GNG5)
   04727 GABAergic synapse
    107543194 (GNG5)
   04725 Cholinergic synapse
    107543194 (GNG5)
   04728 Dopaminergic synapse
    107543194 (GNG5)
   04726 Serotonergic synapse
    107543194 (GNG5)
   04723 Retrograde endocannabinoid signaling
    107543194 (GNG5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107543194 (GNG5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543194 (GNG5)
  09165 Substance dependence
   05032 Morphine addiction
    107543194 (GNG5)
   05034 Alcoholism
    107543194 (GNG5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107543194 (GNG5)
   05163 Human cytomegalovirus infection
    107543194 (GNG5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107543194 (GNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107543194 (GNG5)
   04031 GTP-binding proteins [BR:mna04031]
    107543194 (GNG5)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107543194 (GNG5)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107543194 (GNG5)
SSDB
Motif
Pfam: G-gamma CUPID Suv3_N FtsX_ECD
Other DBs
NCBI-GeneID: 107543194
NCBI-ProteinID: XP_016076138
LinkDB
Position
Unknown
AA seq 68 aa
MSGSSSVTAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL
NT seq 207 nt   +upstreamnt  +downstreamnt
atgtctggttcctccagcgtcaccgcgatgaagaaagtggttcaacagcttcggctggag
gccgggctcaaccgcgtgaaggtttcccaggcagctgcagatttgaaacaattctgtctg
cagaatgctcaacatgaccccctgctgactggagtatcttcaagtaccaatcccttcaga
ccccagaaagtctgttcctttttgtag

KEGG   Miniopterus natalensis: 107543463
Entry
107543463         CDS       T05883                                 

Gene name
GNAO1
Definition
(RefSeq) guanine nucleotide-binding protein G(o) subunit alpha isoform X1
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107543463 (GNAO1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107543463 (GNAO1)
   04921 Oxytocin signaling pathway
    107543463 (GNAO1)
   04926 Relaxin signaling pathway
    107543463 (GNAO1)
   04916 Melanogenesis
    107543463 (GNAO1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107543463 (GNAO1)
   04727 GABAergic synapse
    107543463 (GNAO1)
   04725 Cholinergic synapse
    107543463 (GNAO1)
   04728 Dopaminergic synapse
    107543463 (GNAO1)
   04726 Serotonergic synapse
    107543463 (GNAO1)
   04730 Long-term depression
    107543463 (GNAO1)
   04723 Retrograde endocannabinoid signaling
    107543463 (GNAO1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107543463 (GNAO1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107543463 (GNAO1)
   05034 Alcoholism
    107543463 (GNAO1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107543463 (GNAO1)
   05163 Human cytomegalovirus infection
    107543463 (GNAO1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107543463 (GNAO1)
   05142 Chagas disease
    107543463 (GNAO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107543463 (GNAO1)
   04031 GTP-binding proteins [BR:mna04031]
    107543463 (GNAO1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107543463 (GNAO1)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107543463 (GNAO1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc Ras TniB AAA_29 AAA_24 Cas_Cmr5 DUF685
Other DBs
NCBI-GeneID: 107543463
NCBI-ProteinID: XP_016076484
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SPELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGATDYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGPSAFTEA
VAYIQAQYESKNKSAHKEIYTHITCATDTNNIQFVFDAVTDVIIAKNLRGCGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctggagcggagcaaggcgattgag
aaaaacctcaaagaggatggcatcagcgccgccaaagacgtgaaattactcctgctgggg
gctggagaatcgggaaaaagcaccattgtgaagcagatgaagatcatccatgaagacggc
ttctccggagaagacgtgaagcagtacaagcctgtcgtctacagcaacaccatccagtcg
ctggcagccattgtccgggccatggacactttgggcatcgagtacggtgacaaggagaga
aaggccgacgccaagatggtgtgcgacgtggtgagtcggatggaagacaccgagcccttc
tctccagaactgctatcggccatgatgcggctctggggcgactcggggatccaggagtgc
ttcaaccggtctcgggagtatcagctcaacgactcggccaaatactacctggacagcctg
gatcggatcggggccaccgactaccagcccactgagcaggacatccttcgaaccagggtc
aaaaccaccggcatcgtagaaacccacttcacattcaagaaccttcacttcaggctgttc
gatgtcgggggacaacgatctgaacgcaagaagtggatccactgcttcgaggacgtcacg
gccatcatcttctgtgtcgcgctcagcggctatgaccaggtgctccatgaagacgagacc
acgaaccgcatgcacgagtccctgaagctgttcgacagcatctgcaacaacaagtggttc
acggacacatccatcatcctgttcctcaacaagaaggacctgttcgaggagaagatcagg
aagtccccgctgaccatctgcttccccgagtacacaggccccagcgccttcacggaagcc
gtggcctacatccaagcccagtacgaaagcaagaacaagtcggcccacaaggagatctat
acccacatcacctgcgccactgacaccaacaacatccagtttgtctttgacgctgtgacg
gatgtcatcatcgccaaaaacctgcggggttgtggcctctactga

KEGG   Miniopterus natalensis: 107544078
Entry
107544078         CDS       T05883                                 

Gene name
GNB3
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
  KO
K07825  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04742  Taste transduction
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107544078 (GNB3)
   04371 Apelin signaling pathway
    107544078 (GNB3)
   04151 PI3K-Akt signaling pathway
    107544078 (GNB3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107544078 (GNB3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107544078 (GNB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107544078 (GNB3)
   04727 GABAergic synapse
    107544078 (GNB3)
   04725 Cholinergic synapse
    107544078 (GNB3)
   04728 Dopaminergic synapse
    107544078 (GNB3)
   04726 Serotonergic synapse
    107544078 (GNB3)
   04723 Retrograde endocannabinoid signaling
    107544078 (GNB3)
  09157 Sensory system
   04742 Taste transduction
    107544078 (GNB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107544078 (GNB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544078 (GNB3)
  09165 Substance dependence
   05032 Morphine addiction
    107544078 (GNB3)
   05034 Alcoholism
    107544078 (GNB3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107544078 (GNB3)
   05163 Human cytomegalovirus infection
    107544078 (GNB3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544078 (GNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107544078 (GNB3)
   04031 GTP-binding proteins [BR:mna04031]
    107544078 (GNB3)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107544078 (GNB3)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    107544078 (GNB3)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like Cytochrom_D1
Other DBs
NCBI-GeneID: 107544078
NCBI-ProteinID: XP_016077322
LinkDB
Position
Unknown
AA seq 340 aa
MGEMEQLRQEAEQLKKQIADARKACADITLTELVSGLEVVGRVQMRTRRTLRGHLAKIYA
MHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNM
CSIYSLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVF
VGHTGDCMSLAVSPDFKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPSGEA
ICTGSDDASCRLFDLRADQELTAYSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSM
KGERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggggagatggagcagctgcggcaggaagcagaacagctcaagaagcagattgcagat
gccaggaaagcctgtgctgacattactctgacagagcttgtgtctggcctagaagtcgtg
ggacgagtccagatgcggacgaggcggactttaaggggacacctggccaagatttatgcc
atgcactgggccactgactctaagttgctagtaagtgcctcacaagatgggaagctgatc
gtctgggatacctacaccaccaataaggtacacgccatccctctgcgctcctcttgggtc
atgacctgtgcctatgctccatcagggaactttgtggcatgtggggggctggacaacatg
tgctccatctacagcctcaaatcccgtgagggcaatgtcaaggtcagccgggagctctct
gctcacacaggttatctctcctgttgccgctttctggatgacaacaacattgtgaccagc
tcaggggacaccacgtgtgctctgtgggatatcgagaccgggcagcagaagactgtgttt
gtgggacacacaggggactgcatgagcctggctgtgtctcctgacttcaaactcttcatt
tcgggggcctgtgatgccagcgccaagctctgggacgtgcgcgaggggacttgccggcag
acgtttactggtcatgagtcggacatcaacgccatctgtttcttccccagtggagaggcc
atctgcacaggatctgatgatgcctcctgccgcctgtttgacctgagggcagaccaggag
ctgactgcctactcccacgagagcatcatctgcggcatcacatccgtggccttctccctc
agtggccgcctgctctttgcaggctatgatgacttcaactgcaatgtctgggactccatg
aagggcgagcgtgtgggcatcctctctggccatgacaacagggtcagctgcctgggggtc
acagctgatgggatggcggtggccactggttcctgggacagcttcctcaaaatctggaac
tga

KEGG   Miniopterus natalensis: 107545079
Entry
107545079         CDS       T05883                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04360  Axon guidance
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05133  Pertussis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107545079 (GNAI2)
   04371 Apelin signaling pathway
    107545079 (GNAI2)
   04071 Sphingolipid signaling pathway
    107545079 (GNAI2)
   04024 cAMP signaling pathway
    107545079 (GNAI2)
   04022 cGMP-PKG signaling pathway
    107545079 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107545079 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107545079 (GNAI2)
   04670 Leukocyte transendothelial migration
    107545079 (GNAI2)
   04062 Chemokine signaling pathway
    107545079 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107545079 (GNAI2)
   04915 Estrogen signaling pathway
    107545079 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    107545079 (GNAI2)
   04921 Oxytocin signaling pathway
    107545079 (GNAI2)
   04926 Relaxin signaling pathway
    107545079 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    107545079 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    107545079 (GNAI2)
   04916 Melanogenesis
    107545079 (GNAI2)
   04924 Renin secretion
    107545079 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545079 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    107545079 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107545079 (GNAI2)
   04727 GABAergic synapse
    107545079 (GNAI2)
   04725 Cholinergic synapse
    107545079 (GNAI2)
   04728 Dopaminergic synapse
    107545079 (GNAI2)
   04726 Serotonergic synapse
    107545079 (GNAI2)
   04730 Long-term depression
    107545079 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    107545079 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    107545079 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107545079 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545079 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107545079 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    107545079 (GNAI2)
   05032 Morphine addiction
    107545079 (GNAI2)
   05034 Alcoholism
    107545079 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107545079 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107545079 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107545079 (GNAI2)
   05163 Human cytomegalovirus infection
    107545079 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545079 (GNAI2)
   05142 Chagas disease
    107545079 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545079 (GNAI2)
   04031 GTP-binding proteins [BR:mna04031]
    107545079 (GNAI2)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107545079 (GNAI2)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107545079 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 107545079
NCBI-ProteinID: XP_016078605
LinkDB
Position
Unknown
AA seq 303 aa
MKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSC
TAEEQGVLPEDLSGIIRRLWADHGVQACFSRSREYQLNDSAAYYLNDLERIAQSDYIPTQ
QDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYT
GANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDC
GLF
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaagatcatccatgaggacggctactcagaggaggaatgccggcagtaccgggcagtc
gtctacagcaacaccatccagtctatcatggccattgtcaaagccatgggcaatctgcag
attgattttgctgacccctcccgtgcggacgacgccaggcagctgtttgcgctctcgtgc
acggctgaggagcagggcgtgctccccgaggacctgtccggcatcatccggaggctctgg
gctgaccacggcgtgcaggcctgcttcagccgctcccgggagtaccagctgaacgactcc
gctgcctactacctgaatgacctggagcgcatcgcacagagtgactacatccccacccag
caggacgtgctacggacccgtgtgaagaccacgggcatcgtggagacgcacttcaccttc
aaggacctacacttcaagatgttcgacgtgggcggccagcggtctgagcgtaagaagtgg
atccactgctttgagggtgtcactgccatcatcttctgcgttgccttgagcgcctatgac
ctggtgctagcagaggatgaggagatgaaccgaatgcacgagagcatgaagctgtttgac
agcatctgtaacaacaagtggttcacggacacgtccatcatcctcttcctcaacaagaag
gacctgtttgaggagaagatcacacacagccccctgaccatctgcttcccggagtacaca
ggggccaacaagtacgatgaggccgccagctacatccagagtaagtttgaggacctgaac
aagcgcaaggacaccaaggagatctacacacacttcacgtgtgccactgacaccaagaac
gtgcagttcgtgtttgatgccgtcactgatgtcatcatcaagaacaacctgaaggactgc
ggcctcttctga

KEGG   Miniopterus natalensis: 107545320
Entry
107545320         CDS       T05883                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04360  Axon guidance
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05133  Pertussis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107545320 (GNAI3)
   04371 Apelin signaling pathway
    107545320 (GNAI3)
   04071 Sphingolipid signaling pathway
    107545320 (GNAI3)
   04024 cAMP signaling pathway
    107545320 (GNAI3)
   04022 cGMP-PKG signaling pathway
    107545320 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107545320 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107545320 (GNAI3)
   04670 Leukocyte transendothelial migration
    107545320 (GNAI3)
   04062 Chemokine signaling pathway
    107545320 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107545320 (GNAI3)
   04915 Estrogen signaling pathway
    107545320 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    107545320 (GNAI3)
   04921 Oxytocin signaling pathway
    107545320 (GNAI3)
   04926 Relaxin signaling pathway
    107545320 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    107545320 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    107545320 (GNAI3)
   04916 Melanogenesis
    107545320 (GNAI3)
   04924 Renin secretion
    107545320 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545320 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    107545320 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107545320 (GNAI3)
   04727 GABAergic synapse
    107545320 (GNAI3)
   04725 Cholinergic synapse
    107545320 (GNAI3)
   04728 Dopaminergic synapse
    107545320 (GNAI3)
   04726 Serotonergic synapse
    107545320 (GNAI3)
   04730 Long-term depression
    107545320 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    107545320 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    107545320 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107545320 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545320 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107545320 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    107545320 (GNAI3)
   05032 Morphine addiction
    107545320 (GNAI3)
   05034 Alcoholism
    107545320 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107545320 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107545320 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107545320 (GNAI3)
   05163 Human cytomegalovirus infection
    107545320 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545320 (GNAI3)
   05142 Chagas disease
    107545320 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545320 (GNAI3)
   04031 GTP-binding proteins [BR:mna04031]
    107545320 (GNAI3)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107545320 (GNAI3)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107545320 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE AAA_16
Other DBs
NCBI-GeneID: 107545320
NCBI-ProteinID: XP_016078878
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIRRLWQDGGVQACFCRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKINRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKHNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaaaatgatcgac
cgcaacctgcgtgaggacggggagaaagcggccaaagaagtgaagctgctgctgctcggt
gctggagaatctggtaaaagcaccatcgtgaaacagatgaaaatcattcatgaggacggc
tactcagaggaagaatgtaaacagtataaagtagttgtctacagcaacaccatacagtcc
attattgccatcataagggccatgggcaggctaaagattgactttggggaagctgccaga
gcagatgatgctcggcagttatttgtcctagccggcagcgccgaggaaggagtcatgacc
ccagaactagcgggagtgatccggcggctctggcaggatggcggcgtgcaggcgtgcttc
tgcaggtccagggagtaccagctcaacgactctgcctcatattacctaaatgatttggat
agaatatcccaaaccaactacattccaactcagcaagatgtcctgcggacaagagtgaag
accacaggcattgtggaaacgcatttcaccttcaaagacctgtacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
atcatcttctgcgtggccctcagtgattacgacctggttttggccgaggatgaggagatg
aaccgaatgcatgaaagcatgaaactctttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctcttcctcaacaagaaagacctttttgaggaaaaaataaacagg
agtcccttaactatctgttatccagaatacacgggttccaatacatatgaggaagcagct
gcttacatccagtgccagtttgaagacctgaacagaagaaaagataccaaggagatctac
acccacttcacctgtgccacagacaccaagaacgtgcagtttgttttcgacgcggtcaca
gatgtcatcattaagcacaacttaaaggagtgtggactttactga

KEGG   Miniopterus natalensis: 107546541
Entry
107546541         CDS       T05883                                 

Gene name
GNB5
Definition
(RefSeq) guanine nucleotide-binding protein subunit beta-5
  KO
K04539  guanine nucleotide-binding protein subunit beta-5
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107546541 (GNB5)
   04371 Apelin signaling pathway
    107546541 (GNB5)
   04151 PI3K-Akt signaling pathway
    107546541 (GNB5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107546541 (GNB5)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107546541 (GNB5)
  09156 Nervous system
   04724 Glutamatergic synapse
    107546541 (GNB5)
   04727 GABAergic synapse
    107546541 (GNB5)
   04725 Cholinergic synapse
    107546541 (GNB5)
   04728 Dopaminergic synapse
    107546541 (GNB5)
   04726 Serotonergic synapse
    107546541 (GNB5)
   04723 Retrograde endocannabinoid signaling
    107546541 (GNB5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107546541 (GNB5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107546541 (GNB5)
  09165 Substance dependence
   05032 Morphine addiction
    107546541 (GNB5)
   05034 Alcoholism
    107546541 (GNB5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107546541 (GNB5)
   05163 Human cytomegalovirus infection
    107546541 (GNB5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107546541 (GNB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107546541 (GNB5)
   04031 GTP-binding proteins [BR:mna04031]
    107546541 (GNB5)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107546541 (GNB5)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    107546541 (GNB5)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like DUF2538
Other DBs
NCBI-GeneID: 107546541
NCBI-ProteinID: XP_016080452
LinkDB
Position
Unknown
AA seq 334 aa
MAPRLVLGNGTDRGPVLLVHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRMV
SSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKN
ESMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVL
CLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSD
DATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVS
ILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggctccgaggctggtccttggtaacggaactgaccgtggccctgtcctcctagtgcac
caggtggcggagcgggtggaggccctgggacagtttgtcatgaagaccagaaggaccctc
aaaggccacgggaacaaagttctctgcatggactggtgcaaagataagaggaggatggtg
agctcgtcgcaggacgggaaggtgatcgtgtgggattccttcacaactaacaaggagcac
gcagtcaccatgccctgcacgtgggtgatggcgtgcgcgtatgccccatcgggatgtgcc
attgcgtgtggtggtttggataataagtgttctgtgtatccactgacatttgacaaaaac
gaaagcatggctgccaaaaagaagtccgttgctatgcacacgaactacctgtcggcctgc
agcttcaccaactctgacatgcagatcctgactgcgagcggcgatgggacttgtgccttg
tgggacgtggagagtgggcagctgctgcagagcttccatgggcacggggccgatgtgctc
tgcttggacctggcgccctcagaaacaggaaacaccttcgtgtccgggggatgtgacaag
aaggccatggtgtgggacatgcgctccggccagtgcgtgcaggcctttgaaacacacgaa
tcagacatcaacagtgtccgatactacccgagtggagatgcctttgcctcaggatcagat
gatgctacgtgtcgcctctacgacctccgggcagacagggaggtcgccatctattccaag
gagagtatcatatttggagcatccagcgtggacttctccctcagtggtcgcctgctgttt
gctggatacaatgattataccatcaacgtgtgggatgttcttaaggggtctcgagtctcc
atcctgtttggacatgaaaaccgtgttagtactctgcgagtttctcctgatgggactgct
ttttgctcaggatcatgggatcacaccctaagagtctgggcttaa

DBGET integrated database retrieval system