Miniopterus natalensis: 107525867 Help Entry 107525867         CDS       T05883                                  Gene name GNG2 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2   KO K07826   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107525867 (GNG2)    04371 Apelin signaling pathway     107525867 (GNG2)    04151 PI3K-Akt signaling pathway     107525867 (GNG2)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107525867 (GNG2)   09152 Endocrine system    04926 Relaxin signaling pathway     107525867 (GNG2)   09156 Nervous system    04724 Glutamatergic synapse     107525867 (GNG2)    04727 GABAergic synapse     107525867 (GNG2)    04725 Cholinergic synapse     107525867 (GNG2)    04728 Dopaminergic synapse     107525867 (GNG2)    04726 Serotonergic synapse     107525867 (GNG2)    04723 Retrograde endocannabinoid signaling     107525867 (GNG2)   09159 Environmental adaptation    04713 Circadian entrainment     107525867 (GNG2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107525867 (GNG2)   09165 Substance dependence    05032 Morphine addiction     107525867 (GNG2)    05034 Alcoholism     107525867 (GNG2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107525867 (GNG2)    05163 Human cytomegalovirus infection     107525867 (GNG2)    05167 Kaposi sarcoma-associated herpesvirus infection     107525867 (GNG2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107525867 (GNG2)    04031 GTP-binding proteins [BR:mna04031]     107525867 (GNG2) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107525867 (GNG2) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107525867 (GNG2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma FtsX_ECD CP12 CHASE8 Motif Other DBs NCBI-GeneID:  107525867 NCBI-ProteinID:  XP_016053598 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP FREKKFFCAIL NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggccagcaacaacactgccagcatagcacaagccaggaagctggtggaacagctgaag atggaagccaacattgacaggataaaggtatccaaggcagctgcggacttgatggcctac tgtgaagctcatgccaaggaagacccgctcctgacccccgttccggcttcagagaaccca tttagggagaagaagttcttctgtgccatcctttaa

Miniopterus natalensis: 107527185 Help Entry 107527185         CDS       T05883                                  Gene name GNG4 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4   KO K04541   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107527185 (GNG4)    04371 Apelin signaling pathway     107527185 (GNG4)    04151 PI3K-Akt signaling pathway     107527185 (GNG4)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107527185 (GNG4)   09152 Endocrine system    04926 Relaxin signaling pathway     107527185 (GNG4)   09156 Nervous system    04724 Glutamatergic synapse     107527185 (GNG4)    04727 GABAergic synapse     107527185 (GNG4)    04725 Cholinergic synapse     107527185 (GNG4)    04728 Dopaminergic synapse     107527185 (GNG4)    04726 Serotonergic synapse     107527185 (GNG4)    04723 Retrograde endocannabinoid signaling     107527185 (GNG4)   09159 Environmental adaptation    04713 Circadian entrainment     107527185 (GNG4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107527185 (GNG4)   09165 Substance dependence    05032 Morphine addiction     107527185 (GNG4)    05034 Alcoholism     107527185 (GNG4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107527185 (GNG4)    05163 Human cytomegalovirus infection     107527185 (GNG4)    05167 Kaposi sarcoma-associated herpesvirus infection     107527185 (GNG4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107527185 (GNG4) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107527185 (GNG4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma ATP-synt_F Motif Other DBs NCBI-GeneID:  107527185 NCBI-ProteinID:  XP_016055348 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MKEGMSSNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHAREDPLIVPVPA SENPFREKKFFCTIL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaaggagggcatgtccagcaacagcaccaccagcatctcgcaggcccgcaaggccgtg gagcagctcaagatggaagcctgcatggacagggtgaaggtgtcccaggcagctgcggac ctcctggcatactgtgaggcccacgcccgggaggaccctctgatcgtccccgtgcctgcg tcagaaaacccgttccgagagaagaagttcttctgtaccatcctctga

Miniopterus natalensis: 107533363 Help Entry 107533363         CDS       T05883                                  Gene name GNG13 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13   KO K04547   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04740   Olfactory transduction mna04742   Taste transduction mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107533363 (GNG13)    04371 Apelin signaling pathway     107533363 (GNG13)    04151 PI3K-Akt signaling pathway     107533363 (GNG13)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107533363 (GNG13)   09152 Endocrine system    04926 Relaxin signaling pathway     107533363 (GNG13)   09156 Nervous system    04724 Glutamatergic synapse     107533363 (GNG13)    04727 GABAergic synapse     107533363 (GNG13)    04725 Cholinergic synapse     107533363 (GNG13)    04728 Dopaminergic synapse     107533363 (GNG13)    04726 Serotonergic synapse     107533363 (GNG13)    04723 Retrograde endocannabinoid signaling     107533363 (GNG13)   09157 Sensory system    04740 Olfactory transduction     107533363 (GNG13)    04742 Taste transduction     107533363 (GNG13)   09159 Environmental adaptation    04713 Circadian entrainment     107533363 (GNG13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107533363 (GNG13)   09165 Substance dependence    05032 Morphine addiction     107533363 (GNG13)    05034 Alcoholism     107533363 (GNG13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107533363 (GNG13)    05163 Human cytomegalovirus infection     107533363 (GNG13)    05167 Kaposi sarcoma-associated herpesvirus infection     107533363 (GNG13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107533363 (GNG13) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107533363 (GNG13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  107533363 NCBI-ProteinID:  XP_016063500 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE KGKCAIL NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggaggagtgggacgtgccccagatgaagaaggaggtcgagagcctcaagtaccagctg gccttcaaaagggagatgtcatccaagaccatccctgagctcctcaagtggatcgaggat gggatccccaaggaccccttcctgaaccctgacctcatgaagaacaacccgtgggtggag aagggcaagtgtgccatcctgtga

Miniopterus natalensis: 107533406 Help Entry 107533406         CDS       T05883                                  Gene name GNG12 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12   KO K04347   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Organism mna  Miniopterus natalensis Pathway mna04010   MAPK signaling pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04810   Regulation of actin cytoskeleton mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107533406 (GNG12)    04014 Ras signaling pathway     107533406 (GNG12)    04371 Apelin signaling pathway     107533406 (GNG12)    04151 PI3K-Akt signaling pathway     107533406 (GNG12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     107533406 (GNG12)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107533406 (GNG12)   09152 Endocrine system    04926 Relaxin signaling pathway     107533406 (GNG12)   09156 Nervous system    04724 Glutamatergic synapse     107533406 (GNG12)    04727 GABAergic synapse     107533406 (GNG12)    04725 Cholinergic synapse     107533406 (GNG12)    04728 Dopaminergic synapse     107533406 (GNG12)    04726 Serotonergic synapse     107533406 (GNG12)    04723 Retrograde endocannabinoid signaling     107533406 (GNG12)   09159 Environmental adaptation    04713 Circadian entrainment     107533406 (GNG12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107533406 (GNG12)   09165 Substance dependence    05032 Morphine addiction     107533406 (GNG12)    05034 Alcoholism     107533406 (GNG12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107533406 (GNG12)    05163 Human cytomegalovirus infection     107533406 (GNG12)    05167 Kaposi sarcoma-associated herpesvirus infection     107533406 (GNG12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107533406 (GNG12)    04031 GTP-binding proteins [BR:mna04031]     107533406 (GNG12) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107533406 (GNG12)   Exosomal proteins of colorectal cancer cells    107533406 (GNG12) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107533406 (GNG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  107533406 NCBI-ProteinID:  XP_016063578 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search MSSKTASTNNLTQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE NPFKDKKTCIIL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcaagcaaaaccgcaagcaccaacaacctcacccaggccaggagaactgtgcagcag ttaagactagaagcctccattgaaagaataaaggtttccaaggcgtcggctgacctcatg tcctactgcgaggagcatgccaggagtgaccctctgctgatagggataccaacctcagaa aaccctttcaaggataaaaaaacatgcatcatcttatag

Miniopterus natalensis: 107534609 Help Entry 107534609         CDS       T05883                                  Gene name GNG7 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7   KO K04543   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04740   Olfactory transduction mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107534609 (GNG7)    04371 Apelin signaling pathway     107534609 (GNG7)    04151 PI3K-Akt signaling pathway     107534609 (GNG7)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107534609 (GNG7)   09152 Endocrine system    04926 Relaxin signaling pathway     107534609 (GNG7)   09156 Nervous system    04724 Glutamatergic synapse     107534609 (GNG7)    04727 GABAergic synapse     107534609 (GNG7)    04725 Cholinergic synapse     107534609 (GNG7)    04728 Dopaminergic synapse     107534609 (GNG7)    04726 Serotonergic synapse     107534609 (GNG7)    04723 Retrograde endocannabinoid signaling     107534609 (GNG7)   09157 Sensory system    04740 Olfactory transduction     107534609 (GNG7)   09159 Environmental adaptation    04713 Circadian entrainment     107534609 (GNG7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107534609 (GNG7)   09165 Substance dependence    05032 Morphine addiction     107534609 (GNG7)    05034 Alcoholism     107534609 (GNG7)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107534609 (GNG7)    05163 Human cytomegalovirus infection     107534609 (GNG7)    05167 Kaposi sarcoma-associated herpesvirus infection     107534609 (GNG7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107534609 (GNG7)    04031 GTP-binding proteins [BR:mna04031]     107534609 (GNG7) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107534609 (GNG7)   Exosomal proteins of other body fluids (saliva and urine)    107534609 (GNG7) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107534609 (GNG7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma CP12 FtsX_ECD Motif Other DBs NCBI-GeneID:  107534609 NCBI-ProteinID:  XP_016065255 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search MSATNNIAQARKLVEQLRIEAGIQRIKVSKASSELMSYCEQHARNDPLLVGVPASENPFK DKKPCVIL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtcagccactaacaacatcgcccaggccaggaaactggtggagcagctccgcatcgaa gccgggatccagcgcatcaaggtctccaaagcctcatcggaactcatgagttactgtgag cagcatgcccggaacgaccccctgctggtcggagtccctgcctccgagaaccccttcaag gacaagaagccttgtgtcattctatag

Miniopterus natalensis: 107536795 Help Entry 107536795         CDS       T05883                                  Gene name GNG8 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8   KO K04544   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107536795 (GNG8)    04371 Apelin signaling pathway     107536795 (GNG8)    04151 PI3K-Akt signaling pathway     107536795 (GNG8)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107536795 (GNG8)   09152 Endocrine system    04926 Relaxin signaling pathway     107536795 (GNG8)   09156 Nervous system    04724 Glutamatergic synapse     107536795 (GNG8)    04727 GABAergic synapse     107536795 (GNG8)    04725 Cholinergic synapse     107536795 (GNG8)    04728 Dopaminergic synapse     107536795 (GNG8)    04726 Serotonergic synapse     107536795 (GNG8)    04723 Retrograde endocannabinoid signaling     107536795 (GNG8)   09159 Environmental adaptation    04713 Circadian entrainment     107536795 (GNG8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107536795 (GNG8)   09165 Substance dependence    05032 Morphine addiction     107536795 (GNG8)    05034 Alcoholism     107536795 (GNG8)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107536795 (GNG8)    05163 Human cytomegalovirus infection     107536795 (GNG8)    05167 Kaposi sarcoma-associated herpesvirus infection     107536795 (GNG8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107536795 (GNG8) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107536795 (GNG8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Flexi_CP Motif Other DBs NCBI-GeneID:  107536795 NCBI-ProteinID:  XP_016068119 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPF RDKRLFCVLL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccaacaacatggccaaaatcgcggaagcccgcaagacggtggaacagctgaagctg gaggtgaacatcgaccgcatgaaggtgtcgcaggcggcggcggagctcctggccttctgc gagacgcacgccaaggacgacccgctggtgacgccggtccccgccgcggagaaccccttc cgcgacaagcgccttttctgcgtcctgctctga

Miniopterus natalensis: 107537622 Help Entry 107537622         CDS       T05883                                  Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10-like   KO K04545   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107537622    04371 Apelin signaling pathway     107537622    04151 PI3K-Akt signaling pathway     107537622  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107537622   09152 Endocrine system    04926 Relaxin signaling pathway     107537622   09156 Nervous system    04724 Glutamatergic synapse     107537622    04727 GABAergic synapse     107537622    04725 Cholinergic synapse     107537622    04728 Dopaminergic synapse     107537622    04726 Serotonergic synapse     107537622    04723 Retrograde endocannabinoid signaling     107537622   09159 Environmental adaptation    04713 Circadian entrainment     107537622  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107537622   09165 Substance dependence    05032 Morphine addiction     107537622    05034 Alcoholism     107537622   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107537622    05163 Human cytomegalovirus infection     107537622    05167 Kaposi sarcoma-associated herpesvirus infection     107537622  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107537622 GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107537622 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  107537622 NCBI-ProteinID:  XP_016069157 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MTRVDRRCRRRPRGLDSAASLHSDWNAPYPPKGPFFALEKPLRSCWVSQAAAELQQYCMQ NACKDALLVGVPAGSNPFREPRSCALL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgcgagtggaccggcgatgccggcgacgcccccgcggcctggactcggctgcatcc cttcacagtgattggaatgctccatatcctcccaaaggccccttctttgctttggagaag cctctcagaagttgctgggtctctcaggcggctgcagagctccagcagtactgcatgcag aacgcctgcaaggatgccctgctggtcggtgttcccgcaggaagcaaccccttcagggag cccagatcctgtgctctgctctga

Miniopterus natalensis: 107539173 Help Entry 107539173         CDS       T05883                                  Gene name GNGT2 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2   KO K04549   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107539173 (GNGT2)    04371 Apelin signaling pathway     107539173 (GNGT2)    04151 PI3K-Akt signaling pathway     107539173 (GNGT2)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107539173 (GNGT2)   09152 Endocrine system    04926 Relaxin signaling pathway     107539173 (GNGT2)   09156 Nervous system    04724 Glutamatergic synapse     107539173 (GNGT2)    04727 GABAergic synapse     107539173 (GNGT2)    04725 Cholinergic synapse     107539173 (GNGT2)    04728 Dopaminergic synapse     107539173 (GNGT2)    04726 Serotonergic synapse     107539173 (GNGT2)    04723 Retrograde endocannabinoid signaling     107539173 (GNGT2)   09159 Environmental adaptation    04713 Circadian entrainment     107539173 (GNGT2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107539173 (GNGT2)   09165 Substance dependence    05032 Morphine addiction     107539173 (GNGT2)    05034 Alcoholism     107539173 (GNGT2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107539173 (GNGT2)    05163 Human cytomegalovirus infection     107539173 (GNGT2)    05167 Kaposi sarcoma-associated herpesvirus infection     107539173 (GNGT2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107539173 (GNGT2) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107539173 (GNGT2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Myc-LZ Motif Other DBs NCBI-GeneID:  107539173 NCBI-ProteinID:  XP_016071082 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MAQELSEKELLRMEVEQLKKEARNPRAPISKTGREIKGYVEAHAGNDPLLKGISEDKNPF KEKGTCMIN NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcccaggagctcagcgagaaggagctactgaggatggaagtggagcagctgaagaag gaagcgaggaacccaagggctccgatttccaagacaggaagggaaatcaagggttatgtg gaggcccacgcagggaacgaccctcttctcaaaggcatctctgaggacaagaaccccttc aaggagaaaggcacttgtatgataaactga

Miniopterus natalensis: 107540160 Help Entry 107540160         CDS       T05883                                  Gene name GNB1 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1   KO K04536   guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04740   Olfactory transduction mna04744   Phototransduction mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107540160 (GNB1)    04371 Apelin signaling pathway     107540160 (GNB1)    04151 PI3K-Akt signaling pathway     107540160 (GNB1)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107540160 (GNB1)   09152 Endocrine system    04926 Relaxin signaling pathway     107540160 (GNB1)   09156 Nervous system    04724 Glutamatergic synapse     107540160 (GNB1)    04727 GABAergic synapse     107540160 (GNB1)    04725 Cholinergic synapse     107540160 (GNB1)    04728 Dopaminergic synapse     107540160 (GNB1)    04726 Serotonergic synapse     107540160 (GNB1)    04723 Retrograde endocannabinoid signaling     107540160 (GNB1)   09157 Sensory system    04744 Phototransduction     107540160 (GNB1)    04740 Olfactory transduction     107540160 (GNB1)   09159 Environmental adaptation    04713 Circadian entrainment     107540160 (GNB1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107540160 (GNB1)   09165 Substance dependence    05032 Morphine addiction     107540160 (GNB1)    05034 Alcoholism     107540160 (GNB1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107540160 (GNB1)    05163 Human cytomegalovirus infection     107540160 (GNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     107540160 (GNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107540160 (GNB1)    04031 GTP-binding proteins [BR:mna04031]     107540160 (GNB1) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107540160 (GNB1)   Exosomal proteins of colorectal cancer cells    107540160 (GNB1)   Exosomal proteins of melanoma cells    107540160 (GNB1) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Beta Subunits    Beta [OT]     107540160 (GNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  WD40 ANAPC4_WD40 WD40_like eIF2A Cytochrom_D1 CALM_bind Motif Other DBs NCBI-GeneID:  107540160 NCBI-ProteinID:  XP_016072336 LinkDB All DBs Position Unknown AA seq 340 aa AA seqDB search MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNVDPVGRIQMRTRRTLRGHLAKIYA MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF TGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA FATGSDDATCRLFDLRADQELMIYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt atgagtgagcttgaccagctgcggcaggaggccgagcagctgaaaaaccagatccgagat gccaggaaagcatgtgcagatgcaacactctctcagatcacaaacaacgtggaccctgtg ggaaggatccagatgcgcaccaggagaacgctgcgggggcacctggccaaaatctacgct atgcactggggcacagattccaggcttctcgtgagtgcctctcaggatggtaaactcatc atctgggacagctacaccacaaacaaggtccacgctattcctctgcgctcctcgtgggtc atgacctgtgcgtatgccccttctgggaactacgtggcctgtggtggcctggataacatt tgctccatttacaacctgaagactcgcgaaggaaatgtgcgtgtgagtcgtgaactagcc ggacacacaggttacctgtcctgctgccgcttcctggacgacaatcagattgttaccagc tctggagacaccacctgtgctctgtgggacattgagacgggtcagcagacgaccacgttc acgggacacaccggggacgtcatgagcctctctctcgctcctgacaccaggctgtttgtg tccggtgcttgtgatgcttccgctaaactctgggatgtgcgagaagggatgtgccggcaa accttcaccggccacgagtctgacatcaatgccatctgtttctttccaaatggcaacgca tttgccactggctcggatgacgccacctgcaggctgttcgaccttcgtgcggatcaggag ctcatgatttactcccacgacaacatcatatgtgggatcacctccgtctccttctccaag agtgggcgcctcctcctcgcggggtacgatgacttcaactgcaacgtctgggatgcgctc aaagccgacagggcaggtgtcttggccgggcatgacaaccgcgtcagctgcctgggggtg actgacgatgggatggccgtggcgacagggtcctgggatagcttcctcaagatctggaac taa

Miniopterus natalensis: 107540939 Help Entry 107540939         CDS       T05883                                  Gene name GNB2 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2   KO K04537   guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107540939 (GNB2)    04371 Apelin signaling pathway     107540939 (GNB2)    04151 PI3K-Akt signaling pathway     107540939 (GNB2)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107540939 (GNB2)   09152 Endocrine system    04926 Relaxin signaling pathway     107540939 (GNB2)   09156 Nervous system    04724 Glutamatergic synapse     107540939 (GNB2)    04727 GABAergic synapse     107540939 (GNB2)    04725 Cholinergic synapse     107540939 (GNB2)    04728 Dopaminergic synapse     107540939 (GNB2)    04726 Serotonergic synapse     107540939 (GNB2)    04723 Retrograde endocannabinoid signaling     107540939 (GNB2)   09159 Environmental adaptation    04713 Circadian entrainment     107540939 (GNB2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107540939 (GNB2)   09165 Substance dependence    05032 Morphine addiction     107540939 (GNB2)    05034 Alcoholism     107540939 (GNB2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107540939 (GNB2)    05163 Human cytomegalovirus infection     107540939 (GNB2)    05167 Kaposi sarcoma-associated herpesvirus infection     107540939 (GNB2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107540939 (GNB2)    04031 GTP-binding proteins [BR:mna04031]     107540939 (GNB2) Exosome [BR:mna04147]  Exosomal proteins   Proteins found in most exosomes    107540939 (GNB2) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Beta Subunits    Beta [OT]     107540939 (GNB2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  WD40 ANAPC4_WD40 WD40_like CALM_bind Motif Other DBs NCBI-GeneID:  107540939 NCBI-ProteinID:  XP_016073316 LinkDB All DBs Position Unknown AA seq 340 aa AA seqDB search MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVAF AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggat gcccgaaaagcatgtggggattcaacactgacccagatcacagctgggctggacccagtg gggagaatccagatgaggacacggaggactctccgtgggcacctggcaaaaatctatgcg atgcactgggggacagactcaaggctgctggtcagcgcctcccaggatgggaagctcatc atttgggacagctataccaccaacaaggtccatgccatcccgctacgttcctcctgggtt atgacctgtgcctatgcgccctcagggaactttgtggcctgtggggggttggacaacatc tgctccatctacagcctcaagacccgtgagggcaatgtcagggtcagccgagagctgcct ggccataccgggtacctgtcctgctgccgcttcctggatgacaaccaaatcatcaccagt tctggggacaccacctgtgccctgtgggacattgagacaggccagcagacagtggctttt gctggacacagtggggatgtgatgtccttgtcactggcccccgatggccgcacctttgtg tcaggtgcctgtgatgcctctatcaagctgtgggatgtgcgggattcgatgtgccgacag accttcattggccacgaatcggacatcaatgccgtggctttcttccctaacggctatgcc tttaccaccggctctgacgatgccacgtgccgcctcttcgacctgcgggctgaccaggag ctcctcatgtattcccacgacaacatcatctgcggcatcacctctgttgccttctctcgc agtggccggctgctgcttgctggctacgatgacttcaactgcaacatctgggatgccatg aagggcgaccgtgcaggtgtccttgctggccatgacaaccgtgtgagctgcctcggggta actgatgatggcatggctgtggccacaggctcctgggactccttcctcaagatctggaac taa

Miniopterus natalensis: 107541113 Help Entry 107541113         CDS       T05883                                  Gene name GNB4 Definition (RefSeq) guanine nucleotide-binding protein subunit beta-4   KO K04538   guanine nucleotide-binding protein subunit beta-4 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107541113 (GNB4)    04371 Apelin signaling pathway     107541113 (GNB4)    04151 PI3K-Akt signaling pathway     107541113 (GNB4)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107541113 (GNB4)   09152 Endocrine system    04926 Relaxin signaling pathway     107541113 (GNB4)   09156 Nervous system    04724 Glutamatergic synapse     107541113 (GNB4)    04727 GABAergic synapse     107541113 (GNB4)    04725 Cholinergic synapse     107541113 (GNB4)    04728 Dopaminergic synapse     107541113 (GNB4)    04726 Serotonergic synapse     107541113 (GNB4)    04723 Retrograde endocannabinoid signaling     107541113 (GNB4)   09159 Environmental adaptation    04713 Circadian entrainment     107541113 (GNB4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107541113 (GNB4)   09165 Substance dependence    05032 Morphine addiction     107541113 (GNB4)    05034 Alcoholism     107541113 (GNB4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107541113 (GNB4)    05163 Human cytomegalovirus infection     107541113 (GNB4)    05167 Kaposi sarcoma-associated herpesvirus infection     107541113 (GNB4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107541113 (GNB4)    04031 GTP-binding proteins [BR:mna04031]     107541113 (GNB4) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107541113 (GNB4) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Beta Subunits    Beta [OT]     107541113 (GNB4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  WD40 ANAPC4_WD40 eIF2A WD40_like Motif Other DBs NCBI-GeneID:  107541113 NCBI-ProteinID:  XP_016073571 LinkDB All DBs Position Unknown AA seq 340 aa AA seqDB search MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYA MHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNI CSIYNLKTREGNVRVSRELPGHIGYLSCCRFLDDSQIVTSSGDTNCALWDIETAQQTTTF TGHSGDVMSLSLSPDMRTFVSGACDASAKLWDIRDGMCRQSFSGHVSDINAVSFFPNGYA FATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTL KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt atgagtgaactggaacagttgaggcaggaagctgaacagctacggaatcagatccaggat gctaggaaagcatgtaatgacgcaacgcttgttcagatcacatcaaatatggattctgtg ggtcggatacaaatgcgaacaagacgtacactgagggggcacctcgctaagatctacgcc atgcactggggctatgattcaaggctactagtcagtgcttcccaagatggaaaattaatt atttgggatagctatacaacaaataagatgcatgctattcccctgaggtcctcctgggtg atgacctgcgcctacgctccctcgggaaattacgtggcctgtggaggactggacaacatc tgctccatatataacttaaagaccagagaggggaatgtgagagtgagccgagagttgccg ggtcacataggctacttgtcctgctgtcgttttttagacgacagccaaattgttacaagt tcaggagatacaaattgtgctttatgggacattgaaactgcccagcagaccaccacattc actgggcattctggagatgtgatgagtctttctctgagtcctgacatgagaacttttgtt tctggtgcttgtgatgcctctgccaagttatgggatattcgagatggaatgtgtagacag tctttctctggacatgtgtcagatattaatgctgtcagtttttttccgaatggatatgcc tttgccactggctccgatgatgccacttgccgcctctttgaccttcgtgcagaccaggag ttattattgtattctcatgacaatattatctgtggaatcacctctgtagccttctcaaaa agtgggcgcctcctgttagctggttatgatgactttaattgtaatgtatgggacacactg aaaggagatcgtgcaggtgttcttgctggtcatgacaaccgtgtcagctgtttgggtgta actgatgatggcatggctgtggcaacaggctcttgggacagttttcttagaatctggaat taa

Miniopterus natalensis: 107541527 Help Entry 107541527         CDS       T05883                                  Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7-like   KO K04347   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Organism mna  Miniopterus natalensis Pathway mna04010   MAPK signaling pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04810   Regulation of actin cytoskeleton mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107541527    04014 Ras signaling pathway     107541527    04371 Apelin signaling pathway     107541527    04151 PI3K-Akt signaling pathway     107541527  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     107541527  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107541527   09152 Endocrine system    04926 Relaxin signaling pathway     107541527   09156 Nervous system    04724 Glutamatergic synapse     107541527    04727 GABAergic synapse     107541527    04725 Cholinergic synapse     107541527    04728 Dopaminergic synapse     107541527    04726 Serotonergic synapse     107541527    04723 Retrograde endocannabinoid signaling     107541527   09159 Environmental adaptation    04713 Circadian entrainment     107541527  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107541527   09165 Substance dependence    05032 Morphine addiction     107541527    05034 Alcoholism     107541527   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107541527    05163 Human cytomegalovirus infection     107541527    05167 Kaposi sarcoma-associated herpesvirus infection     107541527  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107541527    04031 GTP-binding proteins [BR:mna04031]     107541527 Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107541527   Exosomal proteins of colorectal cancer cells    107541527 GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107541527 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  107541527 NCBI-ProteinID:  XP_016074102 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MALLTLPQMSGKVATGSDIGQARRAVEQLRMEAGINRMKVSKAAADLLQFCMEQAKSDPF LVGIPAAINPFKEKKPCAIL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggccctgctcacccttcctcagatgtctggcaaagtggccactggcagtgacatcggg caggcccgccgggcagtggagcagctgaggatggaggccggcatcaaccgcatgaaggtg tccaaggcggctgctgacctgctgcagttctgcatggagcaggccaagagtgacccgttc ctggtgggcatcccagctgccatcaaccccttcaaagagaagaagccttgtgccatcctc tga

Miniopterus natalensis: 107541673 Help Entry 107541673         CDS       T05883                                  Gene name GNG11 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11   KO K04546   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107541673 (GNG11)    04371 Apelin signaling pathway     107541673 (GNG11)    04151 PI3K-Akt signaling pathway     107541673 (GNG11)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107541673 (GNG11)   09152 Endocrine system    04926 Relaxin signaling pathway     107541673 (GNG11)   09156 Nervous system    04724 Glutamatergic synapse     107541673 (GNG11)    04727 GABAergic synapse     107541673 (GNG11)    04725 Cholinergic synapse     107541673 (GNG11)    04728 Dopaminergic synapse     107541673 (GNG11)    04726 Serotonergic synapse     107541673 (GNG11)    04723 Retrograde endocannabinoid signaling     107541673 (GNG11)   09159 Environmental adaptation    04713 Circadian entrainment     107541673 (GNG11)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107541673 (GNG11)   09165 Substance dependence    05032 Morphine addiction     107541673 (GNG11)    05034 Alcoholism     107541673 (GNG11)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107541673 (GNG11)    05163 Human cytomegalovirus infection     107541673 (GNG11)    05167 Kaposi sarcoma-associated herpesvirus infection     107541673 (GNG11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107541673 (GNG11) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107541673 (GNG11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma DUF5660 HAUS5 DUF2508 COG2 Macoilin Cep57_CLD_2 Motif Other DBs NCBI-GeneID:  107541673 NCBI-ProteinID:  XP_016074279 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED KNPFKEKGSCIIS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcccgccctgcacatcgaagatctgccagaaaaggaaaagctgaagatggaagttgag caacttcgcaaagaagtgaagttgcagagacagcaggtgtctaaatgttccgaagaaata aaaaactacattgaagaacgttctggggaggatcctctggtgaaaggaattccagaagac aagaacccctttaaagagaaaggcagctgcattatttcctaa

Miniopterus natalensis: 107541750 Help Entry 107541750         CDS       T05883                                  Gene name GNGT1 Definition (RefSeq) guanine nucleotide-binding protein G(T) subunit gamma-T1   KO K04548   guanine nucleotide-binding protein G(T) subunit gamma-T1 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04744   Phototransduction mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107541750 (GNGT1)    04371 Apelin signaling pathway     107541750 (GNGT1)    04151 PI3K-Akt signaling pathway     107541750 (GNGT1)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107541750 (GNGT1)   09152 Endocrine system    04926 Relaxin signaling pathway     107541750 (GNGT1)   09156 Nervous system    04724 Glutamatergic synapse     107541750 (GNGT1)    04727 GABAergic synapse     107541750 (GNGT1)    04725 Cholinergic synapse     107541750 (GNGT1)    04728 Dopaminergic synapse     107541750 (GNGT1)    04726 Serotonergic synapse     107541750 (GNGT1)    04723 Retrograde endocannabinoid signaling     107541750 (GNGT1)   09157 Sensory system    04744 Phototransduction     107541750 (GNGT1)   09159 Environmental adaptation    04713 Circadian entrainment     107541750 (GNGT1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107541750 (GNGT1)   09165 Substance dependence    05032 Morphine addiction     107541750 (GNGT1)    05034 Alcoholism     107541750 (GNGT1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107541750 (GNGT1)    05163 Human cytomegalovirus infection     107541750 (GNGT1)    05167 Kaposi sarcoma-associated herpesvirus infection     107541750 (GNGT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107541750 (GNGT1) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107541750 (GNGT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma DUF2508 Ribosomal_L27A Motif Other DBs NCBI-GeneID:  107541750 NCBI-ProteinID:  XP_016074397 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MPSKRKMPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSRCCEEVRDYVEARSGEDPLV KGIPEDKNPFKELKGGCVIS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccaagcaagcgaaagatgcccgtgatcaatatagaagatctgacagaaaaagacaaa ttgaagatggaagtggaccagctcaagaaagaagtgacactggaaagaatgctggtatcc aggtgctgcgaagaggtcagggattatgttgaagcaaggtccggggaggatccgctagta aagggcatcccagaagacaaaaaccccttcaaggagctcaaaggaggctgcgtgatctca taa

Miniopterus natalensis: 107541861 Help Entry 107541861         CDS       T05883                                  Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10   KO K04545   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107541861    04371 Apelin signaling pathway     107541861    04151 PI3K-Akt signaling pathway     107541861  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107541861   09152 Endocrine system    04926 Relaxin signaling pathway     107541861   09156 Nervous system    04724 Glutamatergic synapse     107541861    04727 GABAergic synapse     107541861    04725 Cholinergic synapse     107541861    04728 Dopaminergic synapse     107541861    04726 Serotonergic synapse     107541861    04723 Retrograde endocannabinoid signaling     107541861   09159 Environmental adaptation    04713 Circadian entrainment     107541861  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107541861   09165 Substance dependence    05032 Morphine addiction     107541861    05034 Alcoholism     107541861   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107541861    05163 Human cytomegalovirus infection     107541861    05167 Kaposi sarcoma-associated herpesvirus infection     107541861  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107541861 GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107541861 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma CP12 Motif Other DBs NCBI-GeneID:  107541861 NCBI-ProteinID:  XP_016074532 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MATMPSGASVHALQRLVEQLKLEASVERIKVSQAAAELQQYCMQNACKDVLLVSVPAGSN PFWGPRSCALL NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggccaccatgccttctggggccagcgtgcatgccctgcagcgcctggtggagcagctc aagctggaggccagtgtggagaggatcaaggtctctcaggcggctgcagagctccagcag tactgtatgcagaacgcctgcaaggatgtcctgctggttagtgttcccgcagggagcaac cctttctgggggcccagatcctgtgccctgctctga

Miniopterus natalensis: 107543109 Help Entry 107543109         CDS       T05883                                  Gene name GNG3 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3   KO K04540   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107543109 (GNG3)    04371 Apelin signaling pathway     107543109 (GNG3)    04151 PI3K-Akt signaling pathway     107543109 (GNG3)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107543109 (GNG3)   09152 Endocrine system    04926 Relaxin signaling pathway     107543109 (GNG3)   09156 Nervous system    04724 Glutamatergic synapse     107543109 (GNG3)    04727 GABAergic synapse     107543109 (GNG3)    04725 Cholinergic synapse     107543109 (GNG3)    04728 Dopaminergic synapse     107543109 (GNG3)    04726 Serotonergic synapse     107543109 (GNG3)    04723 Retrograde endocannabinoid signaling     107543109 (GNG3)   09159 Environmental adaptation    04713 Circadian entrainment     107543109 (GNG3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107543109 (GNG3)   09165 Substance dependence    05032 Morphine addiction     107543109 (GNG3)    05034 Alcoholism     107543109 (GNG3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107543109 (GNG3)    05163 Human cytomegalovirus infection     107543109 (GNG3)    05167 Kaposi sarcoma-associated herpesvirus infection     107543109 (GNG3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mna04031]     107543109 (GNG3) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107543109 (GNG3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  107543109 NCBI-ProteinID:  XP_016076022 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMSYCDAHACEDPLITPVPT SENPFREKKFFCALL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaaaggggagacccctgtgaacagcactatgagtattgggcaagcccgcaagatggtg gaacagcttaagattgaggccagcttgtgtcggataaaggtgtccaaggcagcagcagat ttgatgtcttactgtgatgcccacgcctgtgaggatcccctcatcacccctgtgcccact tcggagaaccccttccgggagaagaagttcttctgtgctctcctctga

Miniopterus natalensis: 107543194 Help Entry 107543194         CDS       T05883                                  Gene name GNG5 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5   KO K04542   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107543194 (GNG5)    04371 Apelin signaling pathway     107543194 (GNG5)    04151 PI3K-Akt signaling pathway     107543194 (GNG5)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107543194 (GNG5)   09152 Endocrine system    04926 Relaxin signaling pathway     107543194 (GNG5)   09156 Nervous system    04724 Glutamatergic synapse     107543194 (GNG5)    04727 GABAergic synapse     107543194 (GNG5)    04725 Cholinergic synapse     107543194 (GNG5)    04728 Dopaminergic synapse     107543194 (GNG5)    04726 Serotonergic synapse     107543194 (GNG5)    04723 Retrograde endocannabinoid signaling     107543194 (GNG5)   09159 Environmental adaptation    04713 Circadian entrainment     107543194 (GNG5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107543194 (GNG5)   09165 Substance dependence    05032 Morphine addiction     107543194 (GNG5)    05034 Alcoholism     107543194 (GNG5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107543194 (GNG5)    05163 Human cytomegalovirus infection     107543194 (GNG5)    05167 Kaposi sarcoma-associated herpesvirus infection     107543194 (GNG5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107543194 (GNG5)    04031 GTP-binding proteins [BR:mna04031]     107543194 (GNG5) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107543194 (GNG5) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     107543194 (GNG5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma CUPID Suv3_N FtsX_ECD Motif Other DBs NCBI-GeneID:  107543194 NCBI-ProteinID:  XP_016076138 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search MSGSSSVTAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR PQKVCSFL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtctggttcctccagcgtcaccgcgatgaagaaagtggttcaacagcttcggctggag gccgggctcaaccgcgtgaaggtttcccaggcagctgcagatttgaaacaattctgtctg cagaatgctcaacatgaccccctgctgactggagtatcttcaagtaccaatcccttcaga ccccagaaagtctgttcctttttgtag

Miniopterus natalensis: 107544078 Help Entry 107544078         CDS       T05883                                  Gene name GNB3 Definition (RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3   KO K07825   guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04742   Taste transduction mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107544078 (GNB3)    04371 Apelin signaling pathway     107544078 (GNB3)    04151 PI3K-Akt signaling pathway     107544078 (GNB3)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107544078 (GNB3)   09152 Endocrine system    04926 Relaxin signaling pathway     107544078 (GNB3)   09156 Nervous system    04724 Glutamatergic synapse     107544078 (GNB3)    04727 GABAergic synapse     107544078 (GNB3)    04725 Cholinergic synapse     107544078 (GNB3)    04728 Dopaminergic synapse     107544078 (GNB3)    04726 Serotonergic synapse     107544078 (GNB3)    04723 Retrograde endocannabinoid signaling     107544078 (GNB3)   09157 Sensory system    04742 Taste transduction     107544078 (GNB3)   09159 Environmental adaptation    04713 Circadian entrainment     107544078 (GNB3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107544078 (GNB3)   09165 Substance dependence    05032 Morphine addiction     107544078 (GNB3)    05034 Alcoholism     107544078 (GNB3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107544078 (GNB3)    05163 Human cytomegalovirus infection     107544078 (GNB3)    05167 Kaposi sarcoma-associated herpesvirus infection     107544078 (GNB3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107544078 (GNB3)    04031 GTP-binding proteins [BR:mna04031]     107544078 (GNB3) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107544078 (GNB3) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Beta Subunits    Beta [OT]     107544078 (GNB3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  WD40 ANAPC4_WD40 eIF2A WD40_like Cytochrom_D1 Motif Other DBs NCBI-GeneID:  107544078 NCBI-ProteinID:  XP_016077322 LinkDB All DBs Position Unknown AA seq 340 aa AA seqDB search MGEMEQLRQEAEQLKKQIADARKACADITLTELVSGLEVVGRVQMRTRRTLRGHLAKIYA MHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNM CSIYSLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVF VGHTGDCMSLAVSPDFKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPSGEA ICTGSDDASCRLFDLRADQELTAYSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSM KGERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt atgggggagatggagcagctgcggcaggaagcagaacagctcaagaagcagattgcagat gccaggaaagcctgtgctgacattactctgacagagcttgtgtctggcctagaagtcgtg ggacgagtccagatgcggacgaggcggactttaaggggacacctggccaagatttatgcc atgcactgggccactgactctaagttgctagtaagtgcctcacaagatgggaagctgatc gtctgggatacctacaccaccaataaggtacacgccatccctctgcgctcctcttgggtc atgacctgtgcctatgctccatcagggaactttgtggcatgtggggggctggacaacatg tgctccatctacagcctcaaatcccgtgagggcaatgtcaaggtcagccgggagctctct gctcacacaggttatctctcctgttgccgctttctggatgacaacaacattgtgaccagc tcaggggacaccacgtgtgctctgtgggatatcgagaccgggcagcagaagactgtgttt gtgggacacacaggggactgcatgagcctggctgtgtctcctgacttcaaactcttcatt tcgggggcctgtgatgccagcgccaagctctgggacgtgcgcgaggggacttgccggcag acgtttactggtcatgagtcggacatcaacgccatctgtttcttccccagtggagaggcc atctgcacaggatctgatgatgcctcctgccgcctgtttgacctgagggcagaccaggag ctgactgcctactcccacgagagcatcatctgcggcatcacatccgtggccttctccctc agtggccgcctgctctttgcaggctatgatgacttcaactgcaatgtctgggactccatg aagggcgagcgtgtgggcatcctctctggccatgacaacagggtcagctgcctgggggtc acagctgatgggatggcggtggccactggttcctgggacagcttcctcaaaatctggaac tga

Miniopterus natalensis: 107546541 Help Entry 107546541         CDS       T05883                                  Gene name GNB5 Definition (RefSeq) guanine nucleotide-binding protein subunit beta-5   KO K04539   guanine nucleotide-binding protein subunit beta-5 Organism mna  Miniopterus natalensis Pathway mna04014   Ras signaling pathway mna04062   Chemokine signaling pathway mna04151   PI3K-Akt signaling pathway mna04371   Apelin signaling pathway mna04713   Circadian entrainment mna04723   Retrograde endocannabinoid signaling mna04724   Glutamatergic synapse mna04725   Cholinergic synapse mna04726   Serotonergic synapse mna04727   GABAergic synapse mna04728   Dopaminergic synapse mna04926   Relaxin signaling pathway mna05032   Morphine addiction mna05034   Alcoholism mna05163   Human cytomegalovirus infection mna05167   Kaposi sarcoma-associated herpesvirus infection mna05170   Human immunodeficiency virus 1 infection mna05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107546541 (GNB5)    04371 Apelin signaling pathway     107546541 (GNB5)    04151 PI3K-Akt signaling pathway     107546541 (GNB5)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     107546541 (GNB5)   09152 Endocrine system    04926 Relaxin signaling pathway     107546541 (GNB5)   09156 Nervous system    04724 Glutamatergic synapse     107546541 (GNB5)    04727 GABAergic synapse     107546541 (GNB5)    04725 Cholinergic synapse     107546541 (GNB5)    04728 Dopaminergic synapse     107546541 (GNB5)    04726 Serotonergic synapse     107546541 (GNB5)    04723 Retrograde endocannabinoid signaling     107546541 (GNB5)   09159 Environmental adaptation    04713 Circadian entrainment     107546541 (GNB5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107546541 (GNB5)   09165 Substance dependence    05032 Morphine addiction     107546541 (GNB5)    05034 Alcoholism     107546541 (GNB5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107546541 (GNB5)    05163 Human cytomegalovirus infection     107546541 (GNB5)    05167 Kaposi sarcoma-associated herpesvirus infection     107546541 (GNB5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mna04147]     107546541 (GNB5)    04031 GTP-binding proteins [BR:mna04031]     107546541 (GNB5) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107546541 (GNB5) GTP-binding proteins [BR:mna04031]  Heterotrimeric G-proteins   Beta Subunits    Beta [OT]     107546541 (GNB5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  WD40 ANAPC4_WD40 WD40_like DUF2538 Motif Other DBs NCBI-GeneID:  107546541 NCBI-ProteinID:  XP_016080452 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MAPRLVLGNGTDRGPVLLVHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRMV SSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKN ESMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVL CLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSD DATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVS ILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atggctccgaggctggtccttggtaacggaactgaccgtggccctgtcctcctagtgcac caggtggcggagcgggtggaggccctgggacagtttgtcatgaagaccagaaggaccctc aaaggccacgggaacaaagttctctgcatggactggtgcaaagataagaggaggatggtg agctcgtcgcaggacgggaaggtgatcgtgtgggattccttcacaactaacaaggagcac gcagtcaccatgccctgcacgtgggtgatggcgtgcgcgtatgccccatcgggatgtgcc attgcgtgtggtggtttggataataagtgttctgtgtatccactgacatttgacaaaaac gaaagcatggctgccaaaaagaagtccgttgctatgcacacgaactacctgtcggcctgc agcttcaccaactctgacatgcagatcctgactgcgagcggcgatgggacttgtgccttg tgggacgtggagagtgggcagctgctgcagagcttccatgggcacggggccgatgtgctc tgcttggacctggcgccctcagaaacaggaaacaccttcgtgtccgggggatgtgacaag aaggccatggtgtgggacatgcgctccggccagtgcgtgcaggcctttgaaacacacgaa tcagacatcaacagtgtccgatactacccgagtggagatgcctttgcctcaggatcagat gatgctacgtgtcgcctctacgacctccgggcagacagggaggtcgccatctattccaag gagagtatcatatttggagcatccagcgtggacttctccctcagtggtcgcctgctgttt gctggatacaatgattataccatcaacgtgtgggatgttcttaaggggtctcgagtctcc atcctgtttggacatgaaaaccgtgttagtactctgcgagtttctcctgatgggactgct ttttgctcaggatcatgggatcacaccctaagagtctgggcttaa

DBGET integrated database retrieval system