KEGG   Miniopterus natalensis: 107525996
Entry
107525996         CDS       T05883                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107525996 (EGFR)
   04012 ErbB signaling pathway
    107525996 (EGFR)
   04014 Ras signaling pathway
    107525996 (EGFR)
   04015 Rap1 signaling pathway
    107525996 (EGFR)
   04630 JAK-STAT signaling pathway
    107525996 (EGFR)
   04066 HIF-1 signaling pathway
    107525996 (EGFR)
   04068 FoxO signaling pathway
    107525996 (EGFR)
   04020 Calcium signaling pathway
    107525996 (EGFR)
   04072 Phospholipase D signaling pathway
    107525996 (EGFR)
   04151 PI3K-Akt signaling pathway
    107525996 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107525996 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107525996 (EGFR)
   04520 Adherens junction
    107525996 (EGFR)
   04540 Gap junction
    107525996 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107525996 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107525996 (EGFR)
   04915 Estrogen signaling pathway
    107525996 (EGFR)
   04921 Oxytocin signaling pathway
    107525996 (EGFR)
   04926 Relaxin signaling pathway
    107525996 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    107525996 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525996 (EGFR)
   05206 MicroRNAs in cancer
    107525996 (EGFR)
   05205 Proteoglycans in cancer
    107525996 (EGFR)
   05230 Central carbon metabolism in cancer
    107525996 (EGFR)
   05231 Choline metabolism in cancer
    107525996 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107525996 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107525996 (EGFR)
   05212 Pancreatic cancer
    107525996 (EGFR)
   05225 Hepatocellular carcinoma
    107525996 (EGFR)
   05226 Gastric cancer
    107525996 (EGFR)
   05214 Glioma
    107525996 (EGFR)
   05218 Melanoma
    107525996 (EGFR)
   05219 Bladder cancer
    107525996 (EGFR)
   05215 Prostate cancer
    107525996 (EGFR)
   05213 Endometrial cancer
    107525996 (EGFR)
   05224 Breast cancer
    107525996 (EGFR)
   05223 Non-small cell lung cancer
    107525996 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107525996 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107525996 (EGFR)
   05171 Coronavirus disease - COVID-19
    107525996 (EGFR)
   05163 Human cytomegalovirus infection
    107525996 (EGFR)
   05165 Human papillomavirus infection
    107525996 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107525996 (EGFR)
   01522 Endocrine resistance
    107525996 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107525996 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107525996 (EGFR)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107525996 (EGFR)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   107525996 (EGFR)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107525996 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   107525996 (EGFR)
  Exosomal proteins of bladder cancer cells
   107525996 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 107525996
NCBI-ProteinID: XP_016053775
LinkDB
Position
Unknown
AA seq 1154 aa
MLNNCEVVLGNLEITYMQKDYDLSFLKTIQEVAGYVLIALNVVEKIPLENLQIIRGNVLF
ENTHALSVLSNYGPNKTGLRELPMRNLQEILQGAVRFNNNPALCNVDTVQWRDIVDSSFL
SNMSLDFQNTYGNCQKCDPSCPNGSCWGSGKENCQQLTKIICAQQCSGRCRGRSPSDCCH
NQCAAGCTGPRESDCLVCRRFRDEATCKDTCPPLMLYNPTTYQMDVNPDGKYSFGATCVK
KCPRNYVVTDHGSCVRACSSDSREVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIQHFRNCTTISGDLHVLPVAFRGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGRFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYAD
TIKWEKLFGTTSQKTKILTNRDGKDCKAQGHICNPLCSSEGCWGPEARDCMSCLNVSRNR
ECVERCNLLEGEPREFVENSECIQCHPECLPQAMNVTCTGRGPDSCVKCAHYMDGPHCVK
TCPAGVMGENSTLVWKFADASHVCHLCHPNCTYGCTGPGPEGCIKPQIPSIAMGIVGGLF
FVLMVALGVGLLLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKI
KVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVNNPHVC
RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEERRLVH
RDLAARNVLVKTPQHIKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQS
DVWSYGVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDA
DSRPKFRELINEFSKMARDPQRYLVIQGDERMHLPSPTDSSFYRTLMEEEDMEDLVDADE
YLVPQQGFFHSPSTSRTPLLSSLSATSNTSTVACIDRNGQSCPLKEDSFLQRYSSDPTGA
LTEDNINDTFLPVPEYINQAVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQNPLSNAVDNP
EYLNTVHPPGVNGVPDGPALWVQKGSHQISLDNPDYQQDFFPREAKSNGIFTGPTAENAD
YLRVGPPSSEFIGA
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgctgaacaactgcgaggtggtccttgggaatttggaaattacctacatgcagaaggac
tatgacctttccttcttaaagaccatccaggaggttgccggctatgtcctcattgccctc
aacgtggtggagaagattcctctggaaaacctgcagatcatccgggggaacgtgctcttt
gagaacacccacgccttgtcagtcctgtccaactatggccccaacaaaaccggcctgagg
gagctgcccatgaggaacctgcaggagatcctgcagggcgcggtgcgcttcaacaacaac
ccggcgctctgcaacgtggacaccgtccagtggcgcgacatcgtcgacagcagtttcctg
agcaacatgtcgctggactttcagaacacgtacggcaactgccagaagtgcgacccaagc
tgtcccaacgggagctgctggggttcgggaaaggagaactgtcagcaactgaccaaaatc
atctgtgcccagcagtgttccgggcgctgccggggcaggtcccccagcgactgctgccac
aaccagtgcgcagcgggctgcaccgggccccgcgagagcgactgcctggtgtgccgcagg
ttccgggatgaagccacgtgcaaggacacctgcccgccgctcatgctgtacaaccccacc
acgtaccagatggacgtcaacccggacgggaagtacagcttcggcgccacctgtgtgaag
aaatgcccccgtaactacgtggtgacagaccacggctcctgcgtccgggcctgcagctcc
gacagccgcgaggtggaggaagacggcgtccgcaagtgtaaaaagtgcgaagggccctgt
cgcaaagtgtgtaacgggatagggatcggagagtttaaggacacgctttccataaacgcc
acgaacatccagcacttccggaactgcaccaccatcagcggggacctgcacgtcctgccc
gtcgcctttcggggcgactccttcacacacacgccgcccctggacccaaaggagctggac
attctgaagaccgtgaaggagatcacagggtttctgctgatccaggcctggccggaaaac
aggacggacctccacgccttcgagaacctggagatcatccggggcaggacaaagcagcac
ggccgcttttctctcgcagtcgtcgggctggacatcacgtccctggggttgcgctccctc
aaggagatcagtgatggagacgtgatcatttcgggaaaccggaacctgtgctacgcggac
acaataaaatgggaaaaactgtttgggaccacgagtcagaaaaccaagatcttaaccaac
agagacgggaaagactgcaaggcccaaggccacatctgtaacccgctgtgctcatccgaa
ggctgctggggcccggaggccagagactgcatgtcctgcctgaatgtcagccgcaaccgg
gagtgcgtggagaggtgcaacctcctggagggcgagccccgggagtttgtggagaactcc
gagtgcatccagtgccacccggagtgcctgccgcaggccatgaacgtgacctgcacggga
cggggaccggacagctgcgtgaagtgtgcccactacatggacggccctcactgcgtcaag
acctgcccggccggggtcatgggcgagaacagcacgctggtctggaagttcgcggacgcc
agtcacgtctgtcacctgtgccaccccaactgcacctacggctgtacggggccgggtcct
gaaggctgcatcaagccccagatcccgtccatcgccatgggcatcgtggggggcctcttc
ttcgtgctgatggtggccctcggcgtcggcctgcttctgcgcaggcgccacatcgtccgc
aagcgcacgctgcgccggctgctgcaggaacgcgagctcgtggagcccctgacgcccagc
ggggaggcgcccaaccaagccctcctgaggatcttaaaggagacagaattcaaaaagatc
aaggtgctgggctccggcgccttcggcaccgtgtacaagggcctctggatccccgaaggc
gagaaggttaaaattcccgtggccatcaaggaattaagagaagccacgtctcccaaagcc
aacaaggaaattctcgacgaagcctacgtgatggccagcgtgaacaacccccacgtgtgc
cgcctgctgggcatctgcctgacctccacggtgcagctcatcacgcagctcatgcccttc
ggctgcctcctcgactacgtccgcgagcacaaggacaacatcggctcccagcacctgctc
aactggtgtgtgcagattgccaagggcatgaactacctggaggagcggcggctggtgcac
cgggacctggcggccaggaacgtcctggtgaagacgccgcagcacatcaagatcacggac
ttcgggctggccaagctgctgggcgccgaggagaaggagtaccacgcggaggggggcaag
gtgcccatcaagtggatggccttggaatctattttacaccgaatctacacccaccaaagt
gacgtctggagctacggagtcaccgtgtgggagctgatgacctttgggtccaagccctac
gacgggatcccggcgagcgagatctcgaccatcctggagaagggagagcgcctcccgcag
ccacccatctgcaccatcgacgtctacatgatcatggtcaagtgctggatgatagatgca
gacagtcgccccaaattccgcgagctgatcaacgaattctccaagatggcccgagacccc
cagcgttaccttgtcatccagggcgacgagaggatgcacctgcccagccccacggactcc
agtttctaccgcacgctgatggaagaggaggacatggaggacctggtggacgccgacgaa
tacctggtcccccagcagggcttcttccacagcccctccacctcccggacgcccctcctg
agctccctgagcgcgaccagcaacacctccaccgtggcctgcatcgacagaaacgggcag
agctgtcccctcaaggaagacagcttcctgcagcggtacagctcagaccccaccggcgcc
ctgactgaggacaacatcaacgacactttcctcccagtgccagaatacataaaccaggcg
gtccccaaaaggcccgcaggctctgtgcagaaccccgtctatcacaaccagcctctgaac
ccagctcccagccgagacccccactaccagaaccccctcagcaacgccgtggacaaccca
gagtatctcaacaccgtccatccccccggcgtcaacggagtccctgacggccctgccctc
tgggtgcagaaaggcagccaccaaatcagcctggacaaccctgactaccagcaggacttc
tttcccagggaggccaagtccaatggcatcttcacaggcccgacggccgaaaatgcagac
tacctgagggtaggcccccccagcagtgaatttattggggcatga

KEGG   Miniopterus natalensis: 107532710
Entry
107532710         CDS       T05883                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107532710 (PDGFRA)
   04014 Ras signaling pathway
    107532710 (PDGFRA)
   04015 Rap1 signaling pathway
    107532710 (PDGFRA)
   04630 JAK-STAT signaling pathway
    107532710 (PDGFRA)
   04020 Calcium signaling pathway
    107532710 (PDGFRA)
   04072 Phospholipase D signaling pathway
    107532710 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    107532710 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107532710 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107532710 (PDGFRA)
   04540 Gap junction
    107532710 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107532710 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532710 (PDGFRA)
   05206 MicroRNAs in cancer
    107532710 (PDGFRA)
   05230 Central carbon metabolism in cancer
    107532710 (PDGFRA)
   05231 Choline metabolism in cancer
    107532710 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    107532710 (PDGFRA)
   05218 Melanoma
    107532710 (PDGFRA)
   05215 Prostate cancer
    107532710 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107532710 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107532710 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107532710 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107532710 (PDGFRA)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107532710 (PDGFRA)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107532710 (PDGFRA)
CD molecules [BR:mna04090]
 Proteins
  107532710 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like DUF3475
Other DBs
NCBI-GeneID: 107532710
NCBI-ProteinID: XP_016062673
LinkDB
Position
Unknown
AA seq 1102 aa
MTRKAETLFQFSRAMGTSHLALLVLGCLLAGPRRGLCQLPLPSILPNENEKVVQLNSSFS
LRCFGESEVTWQYPMSDEDPNVKIRSEENNSGLFVTVLEVANASAAHTGLYTCYYNHTQT
KDSEVEGSHIYIYVPDPDVAFVPLGMTDYLVIVENDDFAVIPCRTTDPQTPVTLLSSDGV
VLADYDSRQGFNGTFTGGPYICEAIVRGKKFQTIPFNIYAVTATSELDLELEAPKTVYKS
GETIVLNCIVFNNEVVDLRWTYPGEVKNKGVIMLEEIKDPSIKLVYTLMVPKATVKDSGD
YECVARLTTREVKEMKKVTISVHEKGFIEIQPSFSQLEAVNLHEVKHFVVDVQAYPPPRI
SWLKDNLTLIENLTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDMKTYTF
ELLTQVPSSIVDLVDDHHGSSGGQTVRCTAAGTPLPDIEWLICKDIKRCNNETSWATLAN
NISNIITEVYALDRSMVEGRVTFAKVEETIAVRCLAKNLLGVENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKTKKELDI
FGLNPADESTRSYVVLSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSVLDSEVKDLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEIYEIMVKCWNSEPEKRPSFYHLR
EIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgactcggaaggcagaaactttgttccagttttccagagctatggggacttcccatctg
gcactcctggtcctaggctgtctcctcgcagggccccggcgaggcctctgccagctccct
ctgccctccatcctcccaaacgagaacgagaaggtcgtgcagctgaactcgtcgttctct
ctgagatgcttcggggagagcgaagtgacctggcagtaccccatgtcggacgaggacccc
aatgtgaagatcaggagcgaggagaacaacagcggcctttttgtgacggtgctggaggtg
gccaacgcctcggcggcccacacgggcctgtacacctgctattacaaccacacgcagacc
aaggacagcgaggtcgaaggcagccacatttacatctacgtgccagacccggatgtagcc
tttgtgcctctaggaatgactgattacttggtcatcgtggagaacgatgattttgctgtt
ataccttgccgcacgactgacccgcagactccggtgaccttgctgagcagtgatggggtg
gtcctggctgactatgacagcagacagggcttcaacgggaccttcactggtgggccctat
atctgtgaggccatcgtcagagggaagaagttccagaccattccatttaacatttatgct
gtaacagcaacatcagaacttgatctagaactggaagctcctaaaactgtatataagtcg
ggggaaacaattgtgctcaactgcatcgtctttaacaatgaggtggttgaccttcggtgg
acttaccctggagaagtgaaaaacaaaggcgtcataatgctggaggaaatcaaggaccca
tccatcaaattggtgtacaccctgatggtccccaaggccacggtgaaagacagtggagat
tacgaatgcgttgcccgcctgaccaccagggaggtcaaagaaatgaagaaagtcaccatt
tctgtccatgagaaagggttcattgaaatccaacccagcttcagccagttggaagctgtc
aacctgcatgaagtcaaacattttgtggtggatgtgcaggcctaccccccgccccggata
tcctggctcaaggacaacctgaccctcatcgaaaacctcaccgagatcaccaccgacata
gaaaagatccaggagataaggtaccgaagcaaattgaagctgatccgtgctaaggaagaa
gacagtggccattacactatcgtagttcaaaacgaagatgacatgaagacctacactttc
gaactcttaactcaagttccctcatctattgtggacttggtggacgaccaccacggctct
tcagggggacagactgtgaggtgcacagcggcagggacgcctctccctgacattgagtgg
ttgatctgtaaggacattaagagatgtaataatgagacttcgtgggcaactctggccaac
aacatctcaaacatcatcacggaggtctacgccctagacaggagtatggtggagggccgg
gtgacattcgccaaagtagaggagaccattgcagttcgatgtctggctaagaatctcctt
ggggttgagaatcgagagctaaagctggtggctcccactctgcgctctgagctcacggtg
gcagccgcagtcctggtgctgttggtgattgtgatcatctcactgattgtcctggttgtc
atttggaaacagaaaccaaggtatgaaattcgctggagggtcattgaatctatcagcccc
gatggacatgaatatatttatgtggacccgatgcagctgccttatgactcgagatgggag
tttccaagagatggactagtgctgggtcgaatcctgggatctggtgcgtttggtaaagtg
gttgaaggaactgcctatggattaagccggtcccaacctgtcatgaaagtagcagtgaag
atgcttaaacccacagccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgacccacctggggccacatttaaacattgtcaacttgctgggagcctgtaccaagtca
ggccccatttacatcatcaccgagtactgcttctatggggatttggtcaactatttgcat
aagaatagggacagcttcctgagccaccacccagagaagacaaagaaagagctggacatc
tttggattgaaccctgctgatgaaagcacacggagttatgttgttttatcttttgaaaac
aatggtgactacatggacatgaagcaagctgacaccacacagtacgtccccatgctggaa
agaaaagaagtttctaaatactcggacatccagaggtccctgtatgaccgcccagcctcg
tacaagaagaagtctgtgttagactcagaagtcaaagacctcctttcggatgataactcg
gaaggcttgactctgttggatttgttgagcttcacctatcaagttgcccgaggaatggag
tttttggcttcaaaaaattgtgtccaccgggacctggccgctcgcaacgtcctcctggca
caaggaaaaatcgtgaagatctgtgactttggcctggccagagacatcatgcatgattcg
aactacgtatcaaaaggcagcaccttcctccccgtgaagtggatggctcctgagagcatc
ttcgacaacctctacaccacgctgagtgatgtctggtcttacggcattctgctctgggag
atcttttccctcggtggcacaccctaccctggcatgatggtggattctactttctacaat
aagatcaagagtgggtaccggatggccaagccagaccacgccaccagtgaaatctacgag
atcatggtgaagtgctggaacagcgagccagagaagagaccctccttttaccatctgaga
gagattgtggagaacctgctgcctggacagtataaaaagagttatgaaaagattcacctg
gatttcctgaagagcgaccatcccgccgtggcacgcatgcgagtggatgctgataatgcc
tacattggcgtcacctacaaaaatgaagaggacaagctgaaggactgggagggtggcctg
gatgagcagaggctgagtgctgacagcggctacatcattcctctgcctgacattgaccct
gttcctgaggaggaagacctgggcaagaggaacagacacagctcgcagacatctgaagag
agtgccattgagacaggttccagcagttctaccttcatcaagagagaagacgagaccatt
gaggacatcgacatgatggatgacattggcatagactcctcagacctggtggaggacagc
ttcctttaa

KEGG   Miniopterus natalensis: 107535230
Entry
107535230         CDS       T05883                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107535230 (PDGFRB)
   04014 Ras signaling pathway
    107535230 (PDGFRB)
   04015 Rap1 signaling pathway
    107535230 (PDGFRB)
   04630 JAK-STAT signaling pathway
    107535230 (PDGFRB)
   04020 Calcium signaling pathway
    107535230 (PDGFRB)
   04072 Phospholipase D signaling pathway
    107535230 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    107535230 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107535230 (PDGFRB)
   04540 Gap junction
    107535230 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107535230 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535230 (PDGFRB)
   05206 MicroRNAs in cancer
    107535230 (PDGFRB)
   05230 Central carbon metabolism in cancer
    107535230 (PDGFRB)
   05231 Choline metabolism in cancer
    107535230 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    107535230 (PDGFRB)
   05218 Melanoma
    107535230 (PDGFRB)
   05215 Prostate cancer
    107535230 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107535230 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107535230 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107535230 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107535230 (PDGFRB)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107535230 (PDGFRB)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107535230 (PDGFRB)
CD molecules [BR:mna04090]
 Proteins
  107535230 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 107535230
NCBI-ProteinID: XP_016066086
LinkDB
Position
Unknown
AA seq 1126 aa
MFGLGTCRFQGLCICVSFEERCGGSWALTSGASSPQGQALLLPLLLLLGPQTSQGLVITP
PGPELVLNVSSTLVLTCSGPEPVVWKRMSKKLTQEMVKTEDGNFSSILTLTDVTGIDTGE
YFCTYNNSNEVEAGEQKRLYIFVPDPTMGFLPIFPEEFFIFLTEVTETTIPCRVTDPQLV
VTLHEKKVDDPLPIPYDHQRGFSGTFEDKTYVCKTTIGDKEVDSEPYYVYSLQASSINVS
MNAAQTVVRQGENITITCIVTGNEVVNFEWTYPREESGRLVEPVTDFDIPHIRSTLHIPS
AELGDSGTYICNVSESLYDHQDEKAINVTVVESGYVHLLSELDAVQFAELHRSRTLQVVF
EAYPLPTVLWFKDNRTLGDSNAGEIALSTRNVSETRYVSELTLVRVKVDEAGRYTMLAFH
EDAEAQVSFQLQINVPVRVLELSESHPANGEQTVRCRGRGMPQPHITWSTCSDLKRCPRE
LPPTPLGNSSEEEGQLETNVTYWAEEQEFEVVSILRLRRVDQPLSVRCTLRNLLGDDVQE
VILVPQSLPFKVVVISAILALVVLTIISFIILIMLWQKKPRYEIRWKVIESVSSDGHEYI
YVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTA
RSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTF
LQHCSDKRRRASAELYSNALPVGLPLPSHMSLPGESDGGYMDMSKDESVDYVPMLDMKGD
IKYADIEPSNYMAPYDNYVPSAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASK
NCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLY
TTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKC
WEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAVLRSQARFPGFHGLRS
PLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISC
DSPLELQEEPEPEPQPESRVELEAEPEWLPESSCPEPRAEAEDSFL
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgtttggattagggacatgtcgttttcaagggctgtgcatatgtgtcagctttgaggag
aggtgtggaggctcctgggctctgacatctggtgcctcctctccccaaggccaggcgctc
ttgctgcccctgctgttgttgctaggaccacagacatcccaaggtctggtcatcacacct
ccggggccagagcttgtcctcaatgtctccagcaccttggttctgacctgctcgggtcca
gagcctgtggtgtggaaacggatgtccaagaagctcacgcaagaaatggtcaagaccgag
gatggcaatttctccagcatcctgacgctgactgatgtcactgggatagacacaggagaa
tacttttgtacctacaataactccaatgaggtggaggctggtgagcaaaaacggctctac
atctttgtgccagaccccaccatgggcttcctcccgatcttccccgaggaattcttcatc
tttctcacggaagtaactgagaccacaattccatgccgcgtgacggatccccaactggtg
gtgacactgcatgagaagaaagtggacgatccacttcccatcccctatgaccaccaacgt
ggcttctctgggacctttgaggacaagacctatgtctgcaaaacgaccatcggggacaag
gaggtggattctgagccctactatgtctacagcctccaggcgtcatccatcaatgtctca
atgaatgcagcgcagactgtggttcgccagggcgagaacatcaccatcacgtgcatcgtc
actggcaacgaggtggtcaactttgagtggacgtacccccgcgaggagagtgggcggctg
gtggagccagtgaccgactttgatattccccacatacgttccaccctgcacatccccagt
gctgagctgggcgactcagggacctacatctgcaatgtgtccgagagtttgtacgaccat
caagatgaaaaggccatcaatgtcaccgtggttgagagtggctacgtgcacttgctgagt
gagctggacgctgtacagttcgcggaactgcaccggagccggactctgcaggtggtgttc
gaggcctacccgctgcccactgtcctgtggttcaaggacaaccgcaccctgggcgactcc
aacgccggcgagatcgccctgtccacgcgcaatgtgtccgagactcggtatgtgtcagaa
ctgacactggtgcgagtgaaggtggatgaggctggtcgctacaccatgttggccttccac
gaggatgcggaggcccaggtctccttccagctgcaaatcaatgtgcctgtccgggtgctg
gagctgagtgagagccaccctgccaatggggagcagacagtccgctgtcgtggccggggc
atgcctcagccacacatcacctggtctacctgcagtgaccttaaaaggtgtccgcgcgag
ctgccgcccacgcctctggggaacagctcggaggaggagggccagctggagaccaacgtg
acgtactgggcggaggagcaggagttcgaggtggtgagcatcctgcgcctgcgccgagtg
gatcagccgctgtcggtgcgctgcacgctgcgaaacctgctgggcgacgacgtgcaggag
gtcatcctggtgccccagtccttgcccttcaaggtggtggtgatctcggccatcctggcc
ttggttgtcctaacgatcatctccttcatcatcctcatcatgctctggcagaagaagccc
cgctatgagatccgatggaaggtgattgaatctgtgagttccgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacctgggagctgccgcgggaccagctt
gtgcttggacgtaccctgggctccggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggctacaatgaaagtggctgtcaagatgctaaaatccacagcc
cgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcacctcgggccc
cacctgaatgtggtcaatctgctgggagcctgcaccaaaggagggcccatctacatcatc
actgagtactgccgctacggcgacctggtggactacctacaccgcaacaagcacaccttc
ctgcagcactgctccgacaagcgccgccgggccagcgccgagctctacagcaacgccctg
ccggtcgggctccccctccccagccacatgtccctgcctggggagagtgacggtggctac
atggacatgagcaaggacgagtcggtggactatgtgcccatgctggacatgaaaggagac
atcaaatatgcagacattgagccctccaactacatggctccctatgataactacgtcccc
tccgctcccgaaaggacctgccgagcaactttgattaacgagtccccagtgcttagctac
atggatcttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaag
aattgtgtccaccgagacctggcagccagaaatgtgctcatctgtgagggcaagctggtc
aagatctgtgactttggccttgctcgtgacatcatgcgggactctaactacatctccaaa
ggcagtaccttcctgccgctgaaatggatggcccccgagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtcctttgggatcctactctgggagatctttaccctgggt
ggcaccccttacccagagctgcccatgaacgagcagttttacaatgccatcaagcggggt
taccgcatggcccagcctgcccacgcctccgacgagatttacgagatcatgcagaagtgt
tgggaagagaagtttgagatccgcccccccttttcccagctggtgctgcttctcgagaga
ctgctgggcgagggttacaaaaagaagtaccagcaggtggatgaggagttcctgaggagc
gaccaccccgctgtccttcggtcccaagcccgcttcccaggcttccatgggctccgatcc
cccctggacaccagctcagtcctctacactgctgtgcagcccaacgagggtgacaatgac
tatatcatccccctgcccgaccctaaacccgaggttgctgatgagggcccactggagggc
tcccccagccttgccagctctacgctgaatgaagtcaacacctcctctaccatctcctgt
gacagccccctggaactacaagaggaaccagagccagagccccagcctgagtcccgggtg
gagctggaggcagaaccagagtggctgccggagtcaagctgtcctgagccccgggctgag
gcagaggacagcttcctgtag

DBGET integrated database retrieval system