KEGG   Miniopterus natalensis: 107526006
Entry
107526006         CDS       T05883                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04115  p53 signaling pathway
mna04218  Cellular senescence
mna04935  Growth hormone synthesis, secretion and action
mna05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    107526006 (IGFBP3)
   04218 Cellular senescence
    107526006 (IGFBP3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107526006 (IGFBP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107526006 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107526006 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107526006 (IGFBP3)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    107526006 (IGFBP3)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107526006 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 TIMELESS_C
Other DBs
NCBI-GeneID: 107526006
NCBI-ProteinID: XP_016053787
LinkDB
Position
Unknown
AA seq 207 aa
MNVSVTRLLVGSPGGGGKAGSRDLLLLRQNAEGSSKTPMHPPGFCPRVFPGNGSEPEEEP
STVTARSPAISGTHRAPDSKFHPGHTKIDVIRKGQAKDSQRYKVDYEAQSTVTQNFSSES
KQDTEYGPCRREMEDTMNQLKFLNTLSPKGIHIPNCDRKGFYKKKQCRPSKGRRRGFCWC
VDKYGQPLPGYDPKGKGDVHCDSVESK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaatgttagcgtcaccaggctgctagtgggctccccgggtggaggggggaaggcaggg
agccgtgatttgctgctgctgcggcaaaatgcagaaggctcctccaagacgcctatgcac
cctccagggttttgtccccgtgtctttccaggaaacggcagtgaacctgaggaagagccc
agcacagtgactgcgaggagcccggccatctccggcacacaccgggcccccgactccaag
ttccaccccggccacaccaagatcgacgtaatcaggaaggggcaggccaaggacagccag
cgctacaaggtcgactacgaggcccagagcaccgtcacccagaacttctcctccgagtcc
aagcaggacacagaatatgggccctgccgccgggagatggaagatacgatgaaccagctc
aagttcctgaacacgctgagccccaagggcatccacatccccaactgcgacaggaagggc
ttctacaagaagaagcagtgccgcccatccaaaggcaggaggcgcggcttctgctggtgc
gtggacaaatatgggcagcccctcccgggctacgacccgaagggcaaaggggacgtccac
tgtgacagcgtggagagcaagtga

DBGET integrated database retrieval system